Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IVF2

Protein Details
Accession A0A395IVF2   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-43IKESIERSRKNKAQRNNSNKDKRQTKSAPHydrophilic
NLS Segment(s)
PositionSequence
21-66RSRKNKAQRNNSNKDKRQTKSAPGSRAPSLYKIRAASFEKKSRLRR
99-118ARRKGSRKEGSQGKGKGNRR
Subcellular Location(s) cyto 7.5cyto_mito 7.5, mito 6.5, nucl 5, extr 5
Family & Domain DBs
Amino Acid Sequences MGALAAVLAIPYRSIKESIERSRKNKAQRNNSNKDKRQTKSAPGSRAPSLYKIRAASFEKKSRLRRADSEGAERKSQSLGHLPLVDVPWAESSGVESAARRKGSRKEGSQGKGKGNRRSFFAETEYAIEDDGSKGFCGGNYYADTGCSINSRVSNRFPPFLFGRVRETGLQRNSGTGIFGWSTERRFLHSSTARNTGVNKGLGDTNTLSSQEISINSADKMASDEDYMAFLNKANEDPSAGTSNAASNSRKVEFKTTDDEVDVPGVLVRATKDAWYVSDADEPFVVVALKHDGGLPDEETFARLIAHPPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.23
4 0.33
5 0.43
6 0.53
7 0.59
8 0.62
9 0.71
10 0.76
11 0.78
12 0.78
13 0.78
14 0.78
15 0.81
16 0.87
17 0.86
18 0.9
19 0.91
20 0.9
21 0.9
22 0.88
23 0.8
24 0.8
25 0.77
26 0.76
27 0.76
28 0.75
29 0.73
30 0.69
31 0.7
32 0.63
33 0.6
34 0.52
35 0.49
36 0.47
37 0.43
38 0.42
39 0.4
40 0.38
41 0.4
42 0.44
43 0.45
44 0.47
45 0.52
46 0.55
47 0.61
48 0.68
49 0.71
50 0.73
51 0.71
52 0.68
53 0.69
54 0.7
55 0.65
56 0.67
57 0.65
58 0.6
59 0.56
60 0.5
61 0.43
62 0.35
63 0.32
64 0.25
65 0.24
66 0.23
67 0.24
68 0.24
69 0.23
70 0.24
71 0.24
72 0.22
73 0.14
74 0.12
75 0.1
76 0.1
77 0.09
78 0.07
79 0.07
80 0.08
81 0.09
82 0.08
83 0.08
84 0.12
85 0.17
86 0.19
87 0.19
88 0.23
89 0.3
90 0.4
91 0.47
92 0.47
93 0.51
94 0.58
95 0.62
96 0.65
97 0.62
98 0.61
99 0.62
100 0.64
101 0.64
102 0.63
103 0.6
104 0.55
105 0.57
106 0.51
107 0.44
108 0.41
109 0.34
110 0.27
111 0.27
112 0.24
113 0.17
114 0.15
115 0.12
116 0.09
117 0.08
118 0.07
119 0.06
120 0.05
121 0.05
122 0.05
123 0.05
124 0.08
125 0.08
126 0.09
127 0.1
128 0.11
129 0.11
130 0.11
131 0.12
132 0.09
133 0.09
134 0.08
135 0.08
136 0.08
137 0.11
138 0.13
139 0.15
140 0.18
141 0.25
142 0.26
143 0.28
144 0.27
145 0.27
146 0.26
147 0.28
148 0.28
149 0.22
150 0.25
151 0.24
152 0.26
153 0.24
154 0.25
155 0.28
156 0.27
157 0.29
158 0.24
159 0.23
160 0.22
161 0.2
162 0.18
163 0.11
164 0.11
165 0.07
166 0.08
167 0.1
168 0.1
169 0.11
170 0.15
171 0.15
172 0.17
173 0.19
174 0.2
175 0.26
176 0.3
177 0.33
178 0.33
179 0.39
180 0.36
181 0.35
182 0.36
183 0.31
184 0.29
185 0.26
186 0.22
187 0.18
188 0.19
189 0.18
190 0.19
191 0.16
192 0.14
193 0.13
194 0.13
195 0.12
196 0.11
197 0.11
198 0.11
199 0.1
200 0.1
201 0.1
202 0.11
203 0.1
204 0.11
205 0.1
206 0.08
207 0.1
208 0.09
209 0.09
210 0.09
211 0.09
212 0.09
213 0.1
214 0.1
215 0.09
216 0.08
217 0.09
218 0.1
219 0.1
220 0.11
221 0.11
222 0.11
223 0.11
224 0.12
225 0.14
226 0.16
227 0.15
228 0.15
229 0.14
230 0.16
231 0.17
232 0.2
233 0.18
234 0.17
235 0.21
236 0.23
237 0.26
238 0.26
239 0.31
240 0.31
241 0.34
242 0.39
243 0.37
244 0.36
245 0.35
246 0.34
247 0.26
248 0.23
249 0.19
250 0.13
251 0.1
252 0.09
253 0.07
254 0.08
255 0.08
256 0.09
257 0.1
258 0.1
259 0.12
260 0.13
261 0.14
262 0.15
263 0.16
264 0.16
265 0.22
266 0.21
267 0.2
268 0.19
269 0.18
270 0.16
271 0.15
272 0.13
273 0.06
274 0.08
275 0.11
276 0.12
277 0.12
278 0.13
279 0.13
280 0.15
281 0.18
282 0.18
283 0.14
284 0.16
285 0.16
286 0.16
287 0.15
288 0.13
289 0.12
290 0.11