Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395JBV5

Protein Details
Accession A0A395JBV5   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
47-72ASAGRPKHNKRVRKERWTKYCKMRVVHydrophilic
NLS Segment(s)
PositionSequence
51-61RPKHNKRVRKE
Subcellular Location(s) mito 16.5, mito_nucl 12.333, nucl 7, cyto_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MRHNKDITIHSQFTFKSIIEKINIHKTSRNFILGIKVEGYQYAAETASAGRPKHNKRVRKERWTKYCKMRVVSINLGGISRRSVFPTTTIRNHYEDAMQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.24
3 0.21
4 0.21
5 0.23
6 0.23
7 0.26
8 0.29
9 0.37
10 0.4
11 0.37
12 0.4
13 0.39
14 0.42
15 0.42
16 0.39
17 0.29
18 0.27
19 0.32
20 0.28
21 0.27
22 0.21
23 0.19
24 0.17
25 0.16
26 0.16
27 0.09
28 0.08
29 0.07
30 0.06
31 0.05
32 0.05
33 0.06
34 0.07
35 0.1
36 0.11
37 0.13
38 0.21
39 0.26
40 0.36
41 0.43
42 0.49
43 0.55
44 0.66
45 0.73
46 0.76
47 0.83
48 0.83
49 0.86
50 0.86
51 0.85
52 0.84
53 0.83
54 0.77
55 0.7
56 0.66
57 0.6
58 0.59
59 0.55
60 0.47
61 0.4
62 0.35
63 0.32
64 0.26
65 0.21
66 0.16
67 0.14
68 0.13
69 0.14
70 0.16
71 0.17
72 0.21
73 0.29
74 0.34
75 0.39
76 0.44
77 0.44
78 0.45
79 0.46
80 0.43