Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1C7S9

Protein Details
Accession A1C7S9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
24-49ISPHRFQPRPQSALRRRRQLIQRLCFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 8, mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0048856  P:anatomical structure development  
GO:0043934  P:sporulation  
KEGG act:ACLA_074880  -  
Pfam View protein in Pfam  
PF03452  Anp1  
Amino Acid Sequences MNRHHAFANGYSAYPRGQSRAFSISPHRFQPRPQSALRRRRQLIQRLCFLGGVSILFLVLIFPSWRAAILPTLSLGLLHSSDDLQLQTLRYYDLSAVQGTAQGWEQEERVLMLTPLRDASSHLPMFFSHLRNLTYPHHLIDLAFLVSDSKDATLELLTQMLEEVQNDPDPKMAFGEISVIQKDFGQKVQQDVESRHGFAAQAGRRKLMAQARNWLLSATLRPTHSWVYWRDADVETAPRTILEDLMRHDKDVIVPNVWRPLPDWLGGEQPYDLNSWQESETALALAETLDEDAVIVEGYAEYATWRPHLAYLRDPYGDPDMEMELDGVGGVSILAKAKVFRSGVHFPAFSFEKHAETEAFGKMAKRMGFSVIGLPHYTIWHLYEPSVDDLRHMEEMEQERKAREKEEKDQAERAERVQALFKDPGPQWDIDKAFVQDSIETEQKELDLVNHVVGASDAQASEAQQNGPAVKAPEPSITPVPVAPGKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.21
4 0.22
5 0.24
6 0.27
7 0.33
8 0.33
9 0.34
10 0.42
11 0.47
12 0.49
13 0.55
14 0.57
15 0.52
16 0.57
17 0.64
18 0.63
19 0.6
20 0.63
21 0.67
22 0.7
23 0.79
24 0.83
25 0.82
26 0.75
27 0.79
28 0.81
29 0.8
30 0.8
31 0.77
32 0.76
33 0.69
34 0.67
35 0.57
36 0.48
37 0.38
38 0.28
39 0.2
40 0.12
41 0.08
42 0.07
43 0.06
44 0.06
45 0.05
46 0.04
47 0.05
48 0.05
49 0.05
50 0.07
51 0.07
52 0.07
53 0.08
54 0.09
55 0.12
56 0.12
57 0.13
58 0.12
59 0.13
60 0.12
61 0.12
62 0.11
63 0.09
64 0.08
65 0.08
66 0.08
67 0.08
68 0.09
69 0.1
70 0.1
71 0.09
72 0.11
73 0.11
74 0.11
75 0.11
76 0.12
77 0.11
78 0.12
79 0.11
80 0.13
81 0.14
82 0.13
83 0.13
84 0.12
85 0.14
86 0.13
87 0.13
88 0.11
89 0.1
90 0.11
91 0.11
92 0.12
93 0.1
94 0.11
95 0.1
96 0.1
97 0.1
98 0.09
99 0.1
100 0.1
101 0.1
102 0.11
103 0.1
104 0.1
105 0.12
106 0.16
107 0.22
108 0.23
109 0.22
110 0.22
111 0.21
112 0.27
113 0.29
114 0.27
115 0.22
116 0.24
117 0.26
118 0.26
119 0.3
120 0.27
121 0.29
122 0.28
123 0.26
124 0.24
125 0.23
126 0.22
127 0.19
128 0.17
129 0.1
130 0.09
131 0.08
132 0.07
133 0.07
134 0.07
135 0.06
136 0.05
137 0.05
138 0.05
139 0.06
140 0.06
141 0.06
142 0.06
143 0.07
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.05
150 0.07
151 0.07
152 0.09
153 0.1
154 0.11
155 0.13
156 0.13
157 0.12
158 0.12
159 0.11
160 0.09
161 0.08
162 0.11
163 0.11
164 0.12
165 0.13
166 0.12
167 0.12
168 0.13
169 0.15
170 0.13
171 0.13
172 0.15
173 0.16
174 0.18
175 0.21
176 0.23
177 0.23
178 0.24
179 0.29
180 0.26
181 0.26
182 0.23
183 0.2
184 0.18
185 0.16
186 0.22
187 0.19
188 0.24
189 0.24
190 0.24
191 0.24
192 0.25
193 0.29
194 0.29
195 0.31
196 0.27
197 0.34
198 0.36
199 0.36
200 0.36
201 0.3
202 0.23
203 0.18
204 0.17
205 0.13
206 0.13
207 0.13
208 0.14
209 0.16
210 0.18
211 0.18
212 0.21
213 0.2
214 0.22
215 0.23
216 0.23
217 0.24
218 0.22
219 0.22
220 0.19
221 0.2
222 0.15
223 0.14
224 0.13
225 0.1
226 0.11
227 0.1
228 0.1
229 0.08
230 0.09
231 0.1
232 0.18
233 0.18
234 0.18
235 0.18
236 0.16
237 0.18
238 0.22
239 0.22
240 0.16
241 0.16
242 0.17
243 0.21
244 0.21
245 0.18
246 0.14
247 0.16
248 0.16
249 0.17
250 0.17
251 0.13
252 0.17
253 0.17
254 0.16
255 0.13
256 0.11
257 0.11
258 0.1
259 0.1
260 0.07
261 0.07
262 0.08
263 0.08
264 0.08
265 0.08
266 0.07
267 0.07
268 0.07
269 0.06
270 0.05
271 0.04
272 0.04
273 0.04
274 0.03
275 0.03
276 0.03
277 0.02
278 0.03
279 0.03
280 0.03
281 0.03
282 0.02
283 0.02
284 0.02
285 0.03
286 0.03
287 0.03
288 0.03
289 0.05
290 0.06
291 0.06
292 0.07
293 0.07
294 0.11
295 0.16
296 0.18
297 0.23
298 0.26
299 0.28
300 0.29
301 0.29
302 0.27
303 0.26
304 0.24
305 0.18
306 0.15
307 0.13
308 0.12
309 0.12
310 0.1
311 0.06
312 0.05
313 0.05
314 0.04
315 0.03
316 0.02
317 0.02
318 0.02
319 0.03
320 0.04
321 0.04
322 0.05
323 0.06
324 0.07
325 0.12
326 0.12
327 0.13
328 0.2
329 0.25
330 0.28
331 0.31
332 0.3
333 0.25
334 0.29
335 0.29
336 0.23
337 0.22
338 0.19
339 0.18
340 0.19
341 0.2
342 0.16
343 0.16
344 0.19
345 0.15
346 0.15
347 0.14
348 0.14
349 0.14
350 0.18
351 0.17
352 0.16
353 0.16
354 0.18
355 0.18
356 0.18
357 0.22
358 0.19
359 0.19
360 0.18
361 0.18
362 0.16
363 0.15
364 0.15
365 0.11
366 0.12
367 0.13
368 0.14
369 0.13
370 0.14
371 0.16
372 0.2
373 0.22
374 0.19
375 0.17
376 0.18
377 0.2
378 0.2
379 0.18
380 0.14
381 0.18
382 0.24
383 0.27
384 0.29
385 0.28
386 0.29
387 0.35
388 0.36
389 0.35
390 0.39
391 0.42
392 0.48
393 0.57
394 0.64
395 0.63
396 0.67
397 0.66
398 0.64
399 0.58
400 0.5
401 0.47
402 0.39
403 0.35
404 0.36
405 0.34
406 0.31
407 0.32
408 0.31
409 0.31
410 0.31
411 0.35
412 0.32
413 0.32
414 0.29
415 0.34
416 0.35
417 0.3
418 0.32
419 0.28
420 0.26
421 0.25
422 0.23
423 0.17
424 0.18
425 0.21
426 0.21
427 0.2
428 0.2
429 0.19
430 0.18
431 0.18
432 0.16
433 0.12
434 0.14
435 0.15
436 0.14
437 0.15
438 0.14
439 0.14
440 0.13
441 0.12
442 0.08
443 0.08
444 0.07
445 0.08
446 0.08
447 0.1
448 0.12
449 0.14
450 0.14
451 0.15
452 0.17
453 0.17
454 0.17
455 0.19
456 0.19
457 0.2
458 0.23
459 0.22
460 0.25
461 0.26
462 0.31
463 0.31
464 0.3
465 0.29
466 0.26
467 0.29