Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395INB1

Protein Details
Accession A0A395INB1   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
310-334NPSPRTCCSIHPHPRQLRVRLRLQIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.5, nucl 8.5, cyto 7.5, mito 6, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000269  Cu_amine_oxidase  
IPR015798  Cu_amine_oxidase_C  
IPR036460  Cu_amine_oxidase_C_sf  
IPR016182  Cu_amine_oxidase_N-reg  
Gene Ontology GO:0005507  F:copper ion binding  
GO:0008131  F:primary amine oxidase activity  
GO:0048038  F:quinone binding  
GO:0009308  P:amine metabolic process  
Pfam View protein in Pfam  
PF01179  Cu_amine_oxid  
Amino Acid Sequences MAPPPRPHPLTQLSPEESQKARDRNHPKAELQKFLEIEHNGALNASTPYPKRASRVCYDVIGSNKIPQYHESLVDVEEGVEVSSEIVSTAHHASLTSGEFDQLLKAVWASSFFKEAIAELNIPPISKLWLNHGHMEEVLRMTILASSKPAEYVPELLEQGTRKDMKPINVVQPEGASFVVGDESLVEWQKWRFRVGFNYREGATIHDVWYDGRSVLYRLSISEMTVPYADARSPFYRKQAFDFGDGGAGNYANNLELGCDCLGVIKYFNGTKTESNGTVTTSPNVICLHEQDAGIGWKTHQLAYRPCGGNPSPRTCCSIHPHPRQLRVRLRLQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.53
4 0.47
5 0.45
6 0.47
7 0.47
8 0.47
9 0.53
10 0.6
11 0.64
12 0.73
13 0.73
14 0.71
15 0.74
16 0.75
17 0.74
18 0.68
19 0.64
20 0.55
21 0.5
22 0.5
23 0.41
24 0.36
25 0.29
26 0.25
27 0.19
28 0.18
29 0.17
30 0.11
31 0.12
32 0.11
33 0.14
34 0.15
35 0.19
36 0.24
37 0.26
38 0.3
39 0.35
40 0.4
41 0.41
42 0.46
43 0.44
44 0.42
45 0.42
46 0.41
47 0.38
48 0.37
49 0.32
50 0.31
51 0.31
52 0.3
53 0.3
54 0.27
55 0.3
56 0.27
57 0.28
58 0.25
59 0.23
60 0.22
61 0.21
62 0.19
63 0.12
64 0.1
65 0.08
66 0.06
67 0.05
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.06
76 0.08
77 0.08
78 0.08
79 0.08
80 0.09
81 0.11
82 0.12
83 0.11
84 0.09
85 0.09
86 0.1
87 0.1
88 0.1
89 0.08
90 0.07
91 0.05
92 0.05
93 0.05
94 0.05
95 0.08
96 0.1
97 0.11
98 0.13
99 0.13
100 0.13
101 0.13
102 0.13
103 0.12
104 0.11
105 0.12
106 0.1
107 0.13
108 0.13
109 0.13
110 0.13
111 0.11
112 0.11
113 0.11
114 0.12
115 0.15
116 0.22
117 0.25
118 0.29
119 0.29
120 0.28
121 0.26
122 0.27
123 0.21
124 0.14
125 0.11
126 0.07
127 0.06
128 0.06
129 0.07
130 0.06
131 0.06
132 0.06
133 0.07
134 0.08
135 0.08
136 0.08
137 0.08
138 0.08
139 0.1
140 0.1
141 0.11
142 0.11
143 0.1
144 0.12
145 0.11
146 0.12
147 0.14
148 0.14
149 0.13
150 0.19
151 0.21
152 0.23
153 0.27
154 0.3
155 0.34
156 0.34
157 0.34
158 0.28
159 0.26
160 0.23
161 0.19
162 0.15
163 0.07
164 0.05
165 0.05
166 0.05
167 0.04
168 0.04
169 0.03
170 0.03
171 0.04
172 0.05
173 0.05
174 0.06
175 0.08
176 0.13
177 0.14
178 0.16
179 0.16
180 0.18
181 0.28
182 0.35
183 0.4
184 0.39
185 0.41
186 0.39
187 0.38
188 0.36
189 0.29
190 0.24
191 0.18
192 0.16
193 0.14
194 0.13
195 0.12
196 0.13
197 0.11
198 0.07
199 0.07
200 0.07
201 0.07
202 0.08
203 0.09
204 0.08
205 0.08
206 0.12
207 0.11
208 0.11
209 0.14
210 0.13
211 0.13
212 0.13
213 0.13
214 0.1
215 0.11
216 0.11
217 0.08
218 0.13
219 0.16
220 0.21
221 0.23
222 0.3
223 0.36
224 0.36
225 0.4
226 0.45
227 0.42
228 0.4
229 0.39
230 0.32
231 0.28
232 0.26
233 0.22
234 0.14
235 0.12
236 0.08
237 0.07
238 0.07
239 0.05
240 0.05
241 0.04
242 0.05
243 0.05
244 0.08
245 0.07
246 0.07
247 0.07
248 0.09
249 0.1
250 0.1
251 0.11
252 0.09
253 0.12
254 0.13
255 0.15
256 0.16
257 0.18
258 0.19
259 0.23
260 0.27
261 0.25
262 0.27
263 0.26
264 0.26
265 0.26
266 0.26
267 0.23
268 0.2
269 0.19
270 0.18
271 0.19
272 0.17
273 0.16
274 0.17
275 0.19
276 0.19
277 0.19
278 0.17
279 0.18
280 0.19
281 0.19
282 0.17
283 0.14
284 0.17
285 0.18
286 0.21
287 0.23
288 0.27
289 0.33
290 0.35
291 0.45
292 0.42
293 0.41
294 0.45
295 0.43
296 0.47
297 0.48
298 0.54
299 0.5
300 0.51
301 0.55
302 0.5
303 0.55
304 0.53
305 0.56
306 0.58
307 0.62
308 0.71
309 0.74
310 0.83
311 0.84
312 0.86
313 0.85
314 0.82