Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IY48

Protein Details
Accession A0A395IY48    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
133-174HERLPPRRAHHRARARAPRLLPRLVSRRRRANRPTRPCASAPBasic
NLS Segment(s)
PositionSequence
126-166RKKRQTAHERLPPRRAHHRARARAPRLLPRLVSRRRRANRP
Subcellular Location(s) mito 15, nucl 6, extr 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Amino Acid Sequences MATATPTAATPSPETPRKRPSALRSIIAGSTAGAIEIAITYPFECRGRDLGASGMRECTTLVIGNSLKAGIRFVAFDQYKSLLQDADGKISPVPRTVIAGFGAGVTESLLAVTPFESIKTTLIDDRKKRQTAHERLPPRRAHHRARARAPRLLPRLVSRRRRANRPTRPCASAPTRRCDSSRNRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.55
4 0.59
5 0.62
6 0.65
7 0.66
8 0.69
9 0.67
10 0.63
11 0.57
12 0.53
13 0.46
14 0.39
15 0.3
16 0.19
17 0.15
18 0.11
19 0.08
20 0.05
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.05
29 0.08
30 0.1
31 0.1
32 0.12
33 0.15
34 0.17
35 0.17
36 0.17
37 0.19
38 0.22
39 0.23
40 0.21
41 0.2
42 0.18
43 0.18
44 0.17
45 0.13
46 0.1
47 0.09
48 0.08
49 0.11
50 0.11
51 0.11
52 0.11
53 0.1
54 0.1
55 0.09
56 0.09
57 0.06
58 0.06
59 0.06
60 0.07
61 0.15
62 0.15
63 0.15
64 0.16
65 0.17
66 0.17
67 0.17
68 0.17
69 0.09
70 0.09
71 0.16
72 0.15
73 0.16
74 0.15
75 0.15
76 0.15
77 0.17
78 0.17
79 0.11
80 0.12
81 0.09
82 0.11
83 0.11
84 0.11
85 0.1
86 0.1
87 0.09
88 0.07
89 0.07
90 0.05
91 0.05
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.04
101 0.04
102 0.05
103 0.06
104 0.06
105 0.07
106 0.08
107 0.09
108 0.13
109 0.2
110 0.27
111 0.32
112 0.4
113 0.48
114 0.52
115 0.52
116 0.58
117 0.62
118 0.64
119 0.68
120 0.69
121 0.7
122 0.73
123 0.79
124 0.75
125 0.7
126 0.72
127 0.7
128 0.69
129 0.7
130 0.74
131 0.75
132 0.8
133 0.85
134 0.79
135 0.78
136 0.74
137 0.73
138 0.68
139 0.63
140 0.56
141 0.53
142 0.58
143 0.61
144 0.66
145 0.65
146 0.7
147 0.74
148 0.82
149 0.84
150 0.85
151 0.86
152 0.87
153 0.88
154 0.83
155 0.8
156 0.72
157 0.7
158 0.69
159 0.68
160 0.64
161 0.63
162 0.62
163 0.6
164 0.6
165 0.6