Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IJ86

Protein Details
Accession A0A395IJ86   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
122-147EEEKELKRARDERRRRAEKRQSASADBasic
NLS Segment(s)
PositionSequence
125-141KELKRARDERRRRAEKR
Subcellular Location(s) cyto_nucl 8, nucl 7.5, cyto 7.5, mito 7, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007667  Hypoxia_induced_domain  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04588  HIG_1_N  
PROSITE View protein in PROSITE  
PS51503  HIG1  
Amino Acid Sequences MSNNTPLPSSFDGDTDFYEENRWQKLTRRLKEEPLIPLGCILTSLALVGATRSMRAGDHNRTQRMFRARIYAQGFTLLAMVAGSMYWDSDRKKRKEFEGVLAEQKAKEKNEAWIKELEARDEEEKELKRARDERRRRAEKRQSASADVADAANAAAEEGEKAKKGIMDQVQGVFWGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.2
4 0.17
5 0.19
6 0.21
7 0.23
8 0.25
9 0.26
10 0.24
11 0.32
12 0.42
13 0.5
14 0.54
15 0.59
16 0.6
17 0.66
18 0.71
19 0.67
20 0.62
21 0.58
22 0.51
23 0.42
24 0.38
25 0.3
26 0.23
27 0.18
28 0.13
29 0.06
30 0.05
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.07
42 0.13
43 0.19
44 0.23
45 0.31
46 0.38
47 0.42
48 0.43
49 0.44
50 0.46
51 0.47
52 0.44
53 0.37
54 0.37
55 0.33
56 0.39
57 0.41
58 0.35
59 0.28
60 0.26
61 0.24
62 0.17
63 0.17
64 0.09
65 0.06
66 0.05
67 0.04
68 0.03
69 0.02
70 0.02
71 0.02
72 0.02
73 0.03
74 0.05
75 0.07
76 0.15
77 0.24
78 0.28
79 0.34
80 0.38
81 0.41
82 0.49
83 0.5
84 0.5
85 0.49
86 0.47
87 0.44
88 0.41
89 0.38
90 0.28
91 0.29
92 0.25
93 0.18
94 0.19
95 0.17
96 0.24
97 0.32
98 0.33
99 0.33
100 0.31
101 0.32
102 0.35
103 0.35
104 0.28
105 0.2
106 0.22
107 0.21
108 0.2
109 0.2
110 0.2
111 0.21
112 0.23
113 0.27
114 0.26
115 0.31
116 0.37
117 0.46
118 0.52
119 0.61
120 0.68
121 0.74
122 0.83
123 0.82
124 0.86
125 0.87
126 0.86
127 0.83
128 0.82
129 0.74
130 0.68
131 0.65
132 0.54
133 0.44
134 0.34
135 0.27
136 0.17
137 0.13
138 0.09
139 0.06
140 0.05
141 0.04
142 0.03
143 0.03
144 0.04
145 0.07
146 0.09
147 0.09
148 0.1
149 0.11
150 0.13
151 0.14
152 0.22
153 0.25
154 0.28
155 0.3
156 0.32
157 0.31
158 0.31