Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IQ95

Protein Details
Accession A0A395IQ95    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
188-209TPNTKTTKTNTPRSKTPRRANKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 8, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
Amino Acid Sequences MPLFDYPSPYWDTIGDPALDLIDRMLTVDPDMRYTVDECLAHPWMTQKTISLHDSTDGLVGGLAGLDFSRRKIARERTLLSAINEVKVSKIIQIESDKDPVKIYVKNPNAKSNCINQPASQQEPVQNVTKNEDAPAAQRDPNEFMEMGGKGDQTLFDNNNNKTGESIYPEDVVTKAKSPEIEAPASRTPNTKTTKTNTPRSKTPRRANK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.16
4 0.15
5 0.15
6 0.14
7 0.11
8 0.08
9 0.06
10 0.06
11 0.07
12 0.07
13 0.07
14 0.08
15 0.13
16 0.13
17 0.14
18 0.15
19 0.15
20 0.16
21 0.16
22 0.17
23 0.16
24 0.16
25 0.15
26 0.19
27 0.2
28 0.19
29 0.18
30 0.21
31 0.2
32 0.22
33 0.21
34 0.19
35 0.2
36 0.24
37 0.26
38 0.22
39 0.21
40 0.19
41 0.2
42 0.17
43 0.15
44 0.1
45 0.08
46 0.06
47 0.06
48 0.04
49 0.04
50 0.03
51 0.02
52 0.02
53 0.04
54 0.04
55 0.06
56 0.13
57 0.13
58 0.16
59 0.24
60 0.34
61 0.41
62 0.47
63 0.5
64 0.47
65 0.51
66 0.5
67 0.43
68 0.4
69 0.31
70 0.25
71 0.23
72 0.18
73 0.14
74 0.14
75 0.13
76 0.09
77 0.1
78 0.09
79 0.12
80 0.14
81 0.17
82 0.18
83 0.22
84 0.2
85 0.2
86 0.2
87 0.18
88 0.19
89 0.18
90 0.19
91 0.24
92 0.3
93 0.36
94 0.38
95 0.45
96 0.44
97 0.44
98 0.45
99 0.42
100 0.42
101 0.41
102 0.4
103 0.32
104 0.36
105 0.37
106 0.37
107 0.32
108 0.26
109 0.25
110 0.26
111 0.27
112 0.25
113 0.23
114 0.21
115 0.23
116 0.24
117 0.21
118 0.19
119 0.18
120 0.15
121 0.15
122 0.18
123 0.17
124 0.17
125 0.18
126 0.19
127 0.22
128 0.23
129 0.22
130 0.18
131 0.16
132 0.17
133 0.16
134 0.15
135 0.12
136 0.11
137 0.09
138 0.09
139 0.09
140 0.09
141 0.12
142 0.13
143 0.19
144 0.26
145 0.26
146 0.32
147 0.32
148 0.3
149 0.28
150 0.28
151 0.23
152 0.22
153 0.24
154 0.2
155 0.21
156 0.2
157 0.2
158 0.19
159 0.2
160 0.17
161 0.17
162 0.16
163 0.17
164 0.18
165 0.21
166 0.27
167 0.29
168 0.32
169 0.3
170 0.34
171 0.38
172 0.4
173 0.38
174 0.35
175 0.34
176 0.38
177 0.43
178 0.43
179 0.44
180 0.47
181 0.57
182 0.62
183 0.69
184 0.71
185 0.71
186 0.76
187 0.79
188 0.84
189 0.84