Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A1CLH1

Protein Details
Accession A1CLH1    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
31-50YYCDRCARSRGRKKYLIVRVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 13.5, nucl 9.5
Family & Domain DBs
KEGG act:ACLA_042170  -  
Amino Acid Sequences MAICEGCFDEQGTKYYVSKLVNGTYVYMDEYYCDRCARSRGRKKYLIVRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.22
4 0.2
5 0.21
6 0.21
7 0.2
8 0.2
9 0.2
10 0.19
11 0.15
12 0.14
13 0.12
14 0.1
15 0.09
16 0.07
17 0.08
18 0.1
19 0.11
20 0.12
21 0.12
22 0.14
23 0.21
24 0.31
25 0.41
26 0.49
27 0.58
28 0.67
29 0.74
30 0.79