Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IRH5

Protein Details
Accession A0A395IRH5   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
150-170VDFKKYPKILQWRKKVEERDAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 10.5, nucl 5.5, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010987  Glutathione-S-Trfase_C-like  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR004045  Glutathione_S-Trfase_N  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF02798  GST_N  
PROSITE View protein in PROSITE  
PS50405  GST_CTER  
PS50404  GST_NTER  
CDD cd03046  GST_N_GTT1_like  
Amino Acid Sequences MTSTNQPGIPTFHHLNDSQSQRILWFLEELGIEYTLVCHTRVEGRAPPELKNVHFMGKAPVLVTSENLPIAESSAILGYLIDTYDKEGRFAAQDKIRDESLTSFAGPEYATQFEYLEKQLTDGWFNGKNLGRSDVMLSWPMDFLAAKEYVDFKKYPKILQWRKKVEERDAWKRAIEKGNGYELANI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.38
4 0.4
5 0.36
6 0.33
7 0.31
8 0.28
9 0.29
10 0.26
11 0.18
12 0.14
13 0.12
14 0.12
15 0.12
16 0.13
17 0.12
18 0.11
19 0.1
20 0.09
21 0.09
22 0.09
23 0.1
24 0.09
25 0.08
26 0.09
27 0.14
28 0.17
29 0.2
30 0.23
31 0.26
32 0.33
33 0.34
34 0.35
35 0.35
36 0.37
37 0.33
38 0.33
39 0.31
40 0.27
41 0.26
42 0.25
43 0.23
44 0.21
45 0.21
46 0.16
47 0.16
48 0.14
49 0.13
50 0.13
51 0.11
52 0.1
53 0.1
54 0.1
55 0.09
56 0.08
57 0.08
58 0.08
59 0.05
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.06
71 0.09
72 0.1
73 0.1
74 0.1
75 0.1
76 0.12
77 0.14
78 0.17
79 0.17
80 0.2
81 0.21
82 0.23
83 0.22
84 0.21
85 0.19
86 0.16
87 0.15
88 0.13
89 0.12
90 0.1
91 0.09
92 0.1
93 0.09
94 0.08
95 0.07
96 0.08
97 0.08
98 0.08
99 0.09
100 0.09
101 0.11
102 0.11
103 0.11
104 0.09
105 0.1
106 0.11
107 0.12
108 0.13
109 0.12
110 0.14
111 0.16
112 0.16
113 0.21
114 0.22
115 0.23
116 0.23
117 0.26
118 0.23
119 0.2
120 0.23
121 0.19
122 0.17
123 0.17
124 0.16
125 0.13
126 0.13
127 0.12
128 0.1
129 0.09
130 0.08
131 0.09
132 0.09
133 0.09
134 0.1
135 0.14
136 0.15
137 0.18
138 0.18
139 0.17
140 0.26
141 0.28
142 0.31
143 0.35
144 0.45
145 0.53
146 0.62
147 0.71
148 0.72
149 0.77
150 0.82
151 0.81
152 0.78
153 0.77
154 0.77
155 0.77
156 0.72
157 0.67
158 0.62
159 0.58
160 0.57
161 0.55
162 0.5
163 0.46
164 0.45
165 0.5
166 0.48