Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IVS2

Protein Details
Accession A0A395IVS2    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGKSKLRRKWWREKPGSKPASPRLBasic
NLS Segment(s)
PositionSequence
3-29KSKLRRKWWREKPGSKPASPRLDALKA
63-107KREPKALEALRAPRALRTPRPLRAPPGPRRLPASRSRYQRHRGEG
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MGKSKLRRKWWREKPGSKPASPRLDALKASEAWKRSAETTERSKKRVLPAQLRVLCKQCAPSKREPKALEALRAPRALRTPRPLRAPPGPRRLPASRSRYQRHRGEGGESAKRTTDSPVSQTRASKRSRAAPGQMNLKLLSRNSMRKARVEDAMDIDDDDVAATTQLIEATDPFSNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.89
4 0.83
5 0.81
6 0.78
7 0.77
8 0.68
9 0.62
10 0.57
11 0.54
12 0.5
13 0.45
14 0.4
15 0.32
16 0.33
17 0.34
18 0.3
19 0.27
20 0.28
21 0.26
22 0.23
23 0.27
24 0.28
25 0.31
26 0.39
27 0.47
28 0.5
29 0.51
30 0.53
31 0.52
32 0.56
33 0.58
34 0.57
35 0.56
36 0.59
37 0.67
38 0.69
39 0.67
40 0.62
41 0.57
42 0.49
43 0.41
44 0.39
45 0.35
46 0.37
47 0.39
48 0.47
49 0.54
50 0.58
51 0.66
52 0.61
53 0.59
54 0.6
55 0.56
56 0.5
57 0.43
58 0.42
59 0.37
60 0.37
61 0.33
62 0.26
63 0.29
64 0.3
65 0.29
66 0.34
67 0.36
68 0.39
69 0.46
70 0.46
71 0.46
72 0.5
73 0.55
74 0.55
75 0.59
76 0.56
77 0.51
78 0.55
79 0.53
80 0.5
81 0.49
82 0.49
83 0.46
84 0.52
85 0.57
86 0.6
87 0.65
88 0.66
89 0.62
90 0.59
91 0.54
92 0.49
93 0.49
94 0.46
95 0.44
96 0.38
97 0.33
98 0.29
99 0.28
100 0.25
101 0.21
102 0.21
103 0.17
104 0.21
105 0.27
106 0.3
107 0.32
108 0.36
109 0.4
110 0.42
111 0.43
112 0.43
113 0.41
114 0.46
115 0.51
116 0.52
117 0.53
118 0.53
119 0.56
120 0.58
121 0.56
122 0.49
123 0.42
124 0.38
125 0.34
126 0.27
127 0.28
128 0.26
129 0.31
130 0.36
131 0.43
132 0.44
133 0.47
134 0.54
135 0.51
136 0.52
137 0.48
138 0.43
139 0.39
140 0.38
141 0.33
142 0.26
143 0.23
144 0.16
145 0.13
146 0.1
147 0.06
148 0.05
149 0.05
150 0.04
151 0.04
152 0.05
153 0.05
154 0.06
155 0.06
156 0.06
157 0.1