Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IKV2

Protein Details
Accession A0A395IKV2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
149-175QSKAPPEKTRILCRRKARRLLQVVQVFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, mito 6, E.R. 4, golg 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004835  Chitin_synth  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0004100  F:chitin synthase activity  
Amino Acid Sequences MSMVYFWIIIMIYLMFASIFITVKSIQTQLAKDQFNWTDIIKNQIFYTLIISLASTYLLWFISSFIFFDPWHMFTSFFQYLLLTPTYINILNVYAFCNTHDITWGTKGDDKAEKLPSAILKAGGKVDVNIPTDDGDLNAQYESEMRKIQSKAPPEKTRILCRRKARRLLQVVQVFGRLILVGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.05
5 0.05
6 0.06
7 0.05
8 0.08
9 0.08
10 0.1
11 0.12
12 0.12
13 0.15
14 0.18
15 0.2
16 0.25
17 0.31
18 0.32
19 0.31
20 0.37
21 0.35
22 0.32
23 0.32
24 0.26
25 0.24
26 0.23
27 0.3
28 0.24
29 0.23
30 0.22
31 0.22
32 0.22
33 0.17
34 0.19
35 0.12
36 0.11
37 0.1
38 0.1
39 0.08
40 0.07
41 0.07
42 0.05
43 0.04
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.06
53 0.08
54 0.07
55 0.1
56 0.12
57 0.12
58 0.14
59 0.14
60 0.15
61 0.14
62 0.21
63 0.19
64 0.16
65 0.15
66 0.13
67 0.13
68 0.14
69 0.14
70 0.07
71 0.07
72 0.07
73 0.08
74 0.08
75 0.08
76 0.06
77 0.06
78 0.06
79 0.06
80 0.07
81 0.06
82 0.06
83 0.07
84 0.08
85 0.08
86 0.08
87 0.1
88 0.1
89 0.11
90 0.13
91 0.13
92 0.13
93 0.15
94 0.16
95 0.17
96 0.2
97 0.21
98 0.22
99 0.25
100 0.24
101 0.21
102 0.23
103 0.2
104 0.19
105 0.17
106 0.16
107 0.13
108 0.14
109 0.14
110 0.13
111 0.12
112 0.11
113 0.13
114 0.15
115 0.16
116 0.15
117 0.15
118 0.15
119 0.15
120 0.15
121 0.13
122 0.09
123 0.08
124 0.08
125 0.08
126 0.07
127 0.06
128 0.08
129 0.09
130 0.11
131 0.13
132 0.13
133 0.2
134 0.22
135 0.29
136 0.34
137 0.41
138 0.49
139 0.57
140 0.64
141 0.63
142 0.7
143 0.7
144 0.74
145 0.75
146 0.74
147 0.73
148 0.76
149 0.82
150 0.83
151 0.87
152 0.84
153 0.85
154 0.85
155 0.82
156 0.82
157 0.76
158 0.69
159 0.6
160 0.53
161 0.42
162 0.33
163 0.27