Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IZT4

Protein Details
Accession A0A395IZT4    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
87-109MFFIARRYKKRKLSHRRSNSLMNHydrophilic
NLS Segment(s)
PositionSequence
93-101RYKKRKLSH
Subcellular Location(s) mito 12, nucl 8, extr 3, cyto 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039295  MSB2  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0005034  F:osmosensor activity  
GO:0007232  P:osmosensory signaling pathway via Sho1 osmosensor  
Amino Acid Sequences MWLPQTIIVQSSSTNRATPTNTALATTLPKVDPDWYNNLGSASTTSASRNSGVFQYRRSDTSPKVKSTTAGIVVGAAGAAAAYGAAMFFIARRYKKRKLSHRRSNSLMNPAEMRPIWCYTGGAFMSGGRMTPGAGGNDRDSGGSGRSAGNSLELNKSQHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.23
4 0.26
5 0.27
6 0.28
7 0.28
8 0.27
9 0.26
10 0.25
11 0.24
12 0.23
13 0.21
14 0.19
15 0.14
16 0.15
17 0.15
18 0.18
19 0.2
20 0.21
21 0.26
22 0.26
23 0.27
24 0.27
25 0.26
26 0.22
27 0.19
28 0.16
29 0.12
30 0.09
31 0.09
32 0.1
33 0.11
34 0.12
35 0.12
36 0.12
37 0.12
38 0.15
39 0.19
40 0.2
41 0.21
42 0.25
43 0.26
44 0.28
45 0.3
46 0.31
47 0.31
48 0.4
49 0.43
50 0.41
51 0.42
52 0.4
53 0.37
54 0.35
55 0.33
56 0.24
57 0.19
58 0.15
59 0.12
60 0.12
61 0.11
62 0.07
63 0.04
64 0.02
65 0.02
66 0.02
67 0.01
68 0.01
69 0.01
70 0.01
71 0.01
72 0.01
73 0.01
74 0.02
75 0.02
76 0.05
77 0.1
78 0.12
79 0.2
80 0.27
81 0.36
82 0.46
83 0.55
84 0.64
85 0.71
86 0.8
87 0.84
88 0.87
89 0.86
90 0.81
91 0.8
92 0.73
93 0.71
94 0.61
95 0.51
96 0.43
97 0.36
98 0.35
99 0.27
100 0.24
101 0.18
102 0.18
103 0.18
104 0.16
105 0.16
106 0.13
107 0.18
108 0.17
109 0.15
110 0.13
111 0.12
112 0.13
113 0.13
114 0.13
115 0.08
116 0.08
117 0.07
118 0.09
119 0.11
120 0.11
121 0.13
122 0.16
123 0.17
124 0.18
125 0.19
126 0.17
127 0.16
128 0.15
129 0.14
130 0.13
131 0.13
132 0.12
133 0.13
134 0.14
135 0.13
136 0.14
137 0.16
138 0.17
139 0.22
140 0.24