Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IXD2

Protein Details
Accession A0A395IXD2   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
176-200KGADKGKMTLARRRRRRRGMRYGKHBasic
NLS Segment(s)
PositionSequence
180-200KGKMTLARRRRRRRGMRYGKH
Subcellular Location(s) cyto 13.5, cyto_nucl 13, nucl 9.5, mito 3
Family & Domain DBs
Pfam View protein in Pfam  
PF05833  NFACT_N  
Amino Acid Sequences MKQRFSSIDVKVIAHELSNALVTLRVSNIYDLSSKIFLVKFAKPDNKQQILIDSGFRCHLTDFSRATAAAPSVFVQRLRKYLKTRRVTQVSQIGTDRIIEFQFSDGQYRLYLEFYAGGNIILTDKDLNILTLLRVVDAGEAQEELRVGLKYSLDNRQNYGGVPDLTKERLQEALQKGADKGKMTLARRRRRRRGMRYGKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.12
4 0.11
5 0.11
6 0.1
7 0.08
8 0.09
9 0.09
10 0.09
11 0.09
12 0.1
13 0.1
14 0.11
15 0.12
16 0.12
17 0.13
18 0.13
19 0.15
20 0.14
21 0.13
22 0.15
23 0.15
24 0.17
25 0.2
26 0.22
27 0.24
28 0.32
29 0.4
30 0.4
31 0.5
32 0.57
33 0.57
34 0.56
35 0.51
36 0.47
37 0.41
38 0.39
39 0.34
40 0.25
41 0.22
42 0.21
43 0.21
44 0.17
45 0.14
46 0.16
47 0.14
48 0.19
49 0.19
50 0.19
51 0.2
52 0.2
53 0.2
54 0.18
55 0.15
56 0.1
57 0.09
58 0.09
59 0.1
60 0.11
61 0.12
62 0.16
63 0.17
64 0.24
65 0.27
66 0.33
67 0.39
68 0.48
69 0.56
70 0.59
71 0.64
72 0.66
73 0.68
74 0.63
75 0.6
76 0.59
77 0.49
78 0.44
79 0.38
80 0.29
81 0.22
82 0.22
83 0.16
84 0.1
85 0.08
86 0.07
87 0.06
88 0.07
89 0.09
90 0.08
91 0.1
92 0.09
93 0.1
94 0.1
95 0.1
96 0.1
97 0.08
98 0.08
99 0.07
100 0.08
101 0.07
102 0.08
103 0.07
104 0.06
105 0.06
106 0.06
107 0.06
108 0.04
109 0.05
110 0.04
111 0.04
112 0.05
113 0.05
114 0.06
115 0.06
116 0.06
117 0.06
118 0.08
119 0.08
120 0.07
121 0.07
122 0.07
123 0.06
124 0.06
125 0.06
126 0.04
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.07
133 0.07
134 0.07
135 0.08
136 0.09
137 0.12
138 0.16
139 0.24
140 0.28
141 0.3
142 0.31
143 0.33
144 0.33
145 0.31
146 0.29
147 0.24
148 0.19
149 0.18
150 0.18
151 0.18
152 0.2
153 0.21
154 0.19
155 0.17
156 0.2
157 0.2
158 0.27
159 0.28
160 0.33
161 0.34
162 0.35
163 0.34
164 0.36
165 0.38
166 0.32
167 0.29
168 0.29
169 0.35
170 0.38
171 0.46
172 0.51
173 0.59
174 0.68
175 0.78
176 0.81
177 0.85
178 0.92
179 0.93
180 0.94