Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395J6T6

Protein Details
Accession A0A395J6T6   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKEKAQKKAKKERKNVEAIARAHydrophilic
NLS Segment(s)
PositionSequence
4-14KAQKKAKKERK
Subcellular Location(s) nucl 15, mito_nucl 12.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MKEKAQKKAKKERKNVEAIARAAQREVDRQIVQDSKVEAKRALRLLGSPVKKAQKSLKHFDTIDLTSKKAIELSEKSEVDISTVVEGEGELHTKRGRKINVPLRYKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.84
3 0.82
4 0.78
5 0.69
6 0.65
7 0.57
8 0.48
9 0.39
10 0.36
11 0.28
12 0.25
13 0.25
14 0.24
15 0.21
16 0.22
17 0.26
18 0.25
19 0.24
20 0.23
21 0.22
22 0.24
23 0.25
24 0.26
25 0.24
26 0.23
27 0.27
28 0.27
29 0.26
30 0.2
31 0.18
32 0.22
33 0.27
34 0.27
35 0.23
36 0.26
37 0.31
38 0.31
39 0.33
40 0.36
41 0.37
42 0.42
43 0.48
44 0.47
45 0.46
46 0.46
47 0.44
48 0.41
49 0.34
50 0.35
51 0.29
52 0.26
53 0.22
54 0.22
55 0.2
56 0.17
57 0.16
58 0.14
59 0.15
60 0.2
61 0.26
62 0.26
63 0.27
64 0.27
65 0.27
66 0.22
67 0.2
68 0.16
69 0.09
70 0.09
71 0.08
72 0.07
73 0.07
74 0.07
75 0.07
76 0.08
77 0.08
78 0.11
79 0.14
80 0.18
81 0.24
82 0.31
83 0.36
84 0.42
85 0.52
86 0.6
87 0.67