Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395ISE2

Protein Details
Accession A0A395ISE2   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-46ASGREEPKPLNKRRHSSFHPRRISSHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 16, cyto 8, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004254  AdipoR/HlyIII-related  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF03006  HlyIII  
Amino Acid Sequences MACASSSLTVETYEDATTSTMASGREEPKPLNKRRHSSFHPRRISSEHVMDGEEGLMLKVDIFLSELERRLDFIEKYGNLTFDSSISWSYATLQAVRMRCSQVSGEVLGATKRRARIMVETVESRYQDALAAHETLHEKVHTGIGLLEGILSEFEARAYKVKEKGLRGTAESLMDEGRKIVDEGLEKAREVVDEGFERAKKAAGTVEEHIENAIARAKQHGLIRYEDLPIPWRVNPHIVKGYRFTESKVECIQSMFGLSNETGGVILPWHPTFNRQDMAWARVAFYVSLGATGFVPALELYLTRGGAWSAEFYAPLAKSVTVYLVGAFVLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.1
5 0.1
6 0.09
7 0.1
8 0.1
9 0.13
10 0.19
11 0.22
12 0.26
13 0.29
14 0.32
15 0.4
16 0.5
17 0.56
18 0.61
19 0.66
20 0.71
21 0.75
22 0.81
23 0.8
24 0.81
25 0.83
26 0.83
27 0.83
28 0.77
29 0.74
30 0.7
31 0.69
32 0.64
33 0.58
34 0.51
35 0.42
36 0.4
37 0.35
38 0.3
39 0.22
40 0.16
41 0.1
42 0.07
43 0.06
44 0.05
45 0.05
46 0.05
47 0.05
48 0.04
49 0.05
50 0.06
51 0.09
52 0.12
53 0.14
54 0.15
55 0.15
56 0.16
57 0.17
58 0.21
59 0.17
60 0.17
61 0.22
62 0.21
63 0.25
64 0.26
65 0.25
66 0.21
67 0.22
68 0.2
69 0.14
70 0.14
71 0.11
72 0.1
73 0.1
74 0.09
75 0.08
76 0.1
77 0.12
78 0.12
79 0.12
80 0.15
81 0.19
82 0.21
83 0.24
84 0.25
85 0.24
86 0.23
87 0.24
88 0.21
89 0.19
90 0.19
91 0.17
92 0.15
93 0.13
94 0.13
95 0.13
96 0.13
97 0.12
98 0.14
99 0.15
100 0.16
101 0.17
102 0.18
103 0.22
104 0.27
105 0.29
106 0.29
107 0.29
108 0.29
109 0.3
110 0.28
111 0.23
112 0.18
113 0.13
114 0.12
115 0.11
116 0.1
117 0.1
118 0.1
119 0.09
120 0.11
121 0.12
122 0.11
123 0.12
124 0.11
125 0.1
126 0.1
127 0.11
128 0.08
129 0.07
130 0.07
131 0.06
132 0.06
133 0.06
134 0.05
135 0.04
136 0.04
137 0.03
138 0.03
139 0.02
140 0.02
141 0.03
142 0.04
143 0.04
144 0.07
145 0.09
146 0.13
147 0.17
148 0.21
149 0.26
150 0.28
151 0.33
152 0.34
153 0.34
154 0.31
155 0.3
156 0.26
157 0.22
158 0.2
159 0.15
160 0.11
161 0.1
162 0.09
163 0.06
164 0.05
165 0.05
166 0.05
167 0.05
168 0.07
169 0.08
170 0.1
171 0.14
172 0.15
173 0.14
174 0.14
175 0.14
176 0.12
177 0.13
178 0.1
179 0.08
180 0.09
181 0.1
182 0.13
183 0.13
184 0.14
185 0.12
186 0.13
187 0.11
188 0.11
189 0.12
190 0.12
191 0.15
192 0.16
193 0.18
194 0.17
195 0.17
196 0.16
197 0.14
198 0.11
199 0.09
200 0.11
201 0.09
202 0.09
203 0.11
204 0.12
205 0.16
206 0.19
207 0.23
208 0.22
209 0.24
210 0.27
211 0.27
212 0.28
213 0.25
214 0.22
215 0.2
216 0.2
217 0.2
218 0.18
219 0.19
220 0.19
221 0.26
222 0.27
223 0.3
224 0.36
225 0.36
226 0.37
227 0.39
228 0.4
229 0.36
230 0.35
231 0.31
232 0.31
233 0.31
234 0.33
235 0.32
236 0.31
237 0.27
238 0.27
239 0.26
240 0.17
241 0.17
242 0.14
243 0.1
244 0.11
245 0.1
246 0.1
247 0.09
248 0.09
249 0.07
250 0.06
251 0.06
252 0.05
253 0.07
254 0.09
255 0.1
256 0.12
257 0.12
258 0.17
259 0.22
260 0.26
261 0.27
262 0.24
263 0.32
264 0.33
265 0.37
266 0.38
267 0.33
268 0.29
269 0.28
270 0.29
271 0.21
272 0.18
273 0.16
274 0.1
275 0.11
276 0.09
277 0.08
278 0.08
279 0.08
280 0.08
281 0.05
282 0.06
283 0.05
284 0.06
285 0.05
286 0.05
287 0.07
288 0.1
289 0.1
290 0.1
291 0.1
292 0.1
293 0.1
294 0.11
295 0.11
296 0.11
297 0.11
298 0.11
299 0.12
300 0.17
301 0.16
302 0.17
303 0.17
304 0.14
305 0.15
306 0.15
307 0.17
308 0.12
309 0.12
310 0.11
311 0.1