Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IUL1

Protein Details
Accession A0A395IUL1    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
98-128LLPPHRPQHRRPQQHHRPKRRHPQAPAPSAPBasic
NLS Segment(s)
PositionSequence
103-120RPQHRRPQQHHRPKRRHP
Subcellular Location(s) nucl 18, mito_nucl 11.833, cyto_nucl 11.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000269  Cu_amine_oxidase  
IPR015798  Cu_amine_oxidase_C  
IPR036460  Cu_amine_oxidase_C_sf  
Gene Ontology GO:0005507  F:copper ion binding  
GO:0008131  F:primary amine oxidase activity  
GO:0048038  F:quinone binding  
GO:0009308  P:amine metabolic process  
Pfam View protein in Pfam  
PF01179  Cu_amine_oxid  
PROSITE View protein in PROSITE  
PS01164  COPPER_AMINE_OXID_1  
Amino Acid Sequences MPSASTKKMLVSSSNTPDFRDESVIVTRGRKLIVSHIFTAANYEYCIYWIFHQDGTIQLEIKLTGILNTYSMNPGEDTKGWGTEVYPGVNAHNHQHSLLPPHRPQHRRPQQHHRPKRRHPQAPAPSAPQKTPTATPSMPTEPNTKPSTTPSATTTPPPPAPGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.43
4 0.43
5 0.41
6 0.37
7 0.33
8 0.26
9 0.22
10 0.25
11 0.27
12 0.26
13 0.26
14 0.26
15 0.24
16 0.23
17 0.22
18 0.19
19 0.25
20 0.31
21 0.32
22 0.32
23 0.32
24 0.32
25 0.3
26 0.32
27 0.24
28 0.17
29 0.13
30 0.12
31 0.1
32 0.1
33 0.12
34 0.09
35 0.1
36 0.13
37 0.14
38 0.13
39 0.14
40 0.14
41 0.15
42 0.17
43 0.17
44 0.14
45 0.12
46 0.12
47 0.12
48 0.11
49 0.09
50 0.06
51 0.05
52 0.06
53 0.06
54 0.06
55 0.07
56 0.07
57 0.08
58 0.08
59 0.08
60 0.07
61 0.08
62 0.09
63 0.09
64 0.11
65 0.1
66 0.1
67 0.1
68 0.1
69 0.09
70 0.11
71 0.12
72 0.09
73 0.1
74 0.1
75 0.1
76 0.11
77 0.12
78 0.11
79 0.12
80 0.13
81 0.12
82 0.14
83 0.14
84 0.2
85 0.23
86 0.27
87 0.28
88 0.34
89 0.43
90 0.46
91 0.5
92 0.55
93 0.61
94 0.65
95 0.71
96 0.76
97 0.78
98 0.84
99 0.91
100 0.9
101 0.9
102 0.9
103 0.94
104 0.93
105 0.91
106 0.87
107 0.87
108 0.86
109 0.84
110 0.78
111 0.73
112 0.7
113 0.63
114 0.57
115 0.5
116 0.42
117 0.37
118 0.36
119 0.32
120 0.31
121 0.29
122 0.31
123 0.32
124 0.35
125 0.34
126 0.34
127 0.38
128 0.33
129 0.4
130 0.4
131 0.36
132 0.33
133 0.35
134 0.41
135 0.37
136 0.37
137 0.35
138 0.37
139 0.37
140 0.4
141 0.39
142 0.38
143 0.38