Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395IPV1

Protein Details
Accession A0A395IPV1   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
336-360PSVGTIKPLRKVKKVQKKGQGIEGLHydrophilic
NLS Segment(s)
PositionSequence
345-352RKVKKVQK
Subcellular Location(s) nucl 7, mito 6, cyto 6, plas 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Amino Acid Sequences MSTSREGPNPLRPYYVPPSIGIPQELPITNSGTHGVELPSDDSDADETAYFTSAAPHAESLSPSRRRYSSEGSGWEDRSIPKAAPPKPKPAHQLVLRRSDSIMEVISQEWSKEGAWGVWKGSNATFIYGFLLKTVETWSSSMISAVLNIPDPGLAILGAQIDVAASPSPWTSLGVAIAAAATAGLILAPLDLVRTKLILTPTSDPKRSLTHNLNTLPSYMCPPLLLIPTILHSIIKPTISHCTPLLLRTRLAIDPILTPTSYSTFTFLAQTLEIFICLPIETVLRRGQAAVLSSPQYNEAQDLKTVVEIGPYNGVVGTMWSIVREEGESSGPEPIPSVGTIKPLRKVKKVQKKGQGIEGLWRGWRVGVWGLVGMYGSKAMSGAGSTEGEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.43
4 0.38
5 0.41
6 0.4
7 0.41
8 0.35
9 0.29
10 0.24
11 0.27
12 0.27
13 0.23
14 0.21
15 0.22
16 0.2
17 0.2
18 0.2
19 0.16
20 0.16
21 0.16
22 0.15
23 0.13
24 0.14
25 0.14
26 0.13
27 0.13
28 0.12
29 0.11
30 0.12
31 0.11
32 0.11
33 0.09
34 0.09
35 0.09
36 0.1
37 0.09
38 0.08
39 0.1
40 0.1
41 0.11
42 0.12
43 0.12
44 0.12
45 0.13
46 0.15
47 0.18
48 0.27
49 0.33
50 0.34
51 0.39
52 0.39
53 0.43
54 0.48
55 0.51
56 0.5
57 0.49
58 0.53
59 0.54
60 0.57
61 0.53
62 0.47
63 0.41
64 0.33
65 0.3
66 0.27
67 0.21
68 0.22
69 0.29
70 0.35
71 0.44
72 0.48
73 0.55
74 0.58
75 0.65
76 0.66
77 0.65
78 0.66
79 0.63
80 0.69
81 0.64
82 0.69
83 0.64
84 0.58
85 0.51
86 0.43
87 0.36
88 0.27
89 0.21
90 0.12
91 0.11
92 0.11
93 0.12
94 0.11
95 0.1
96 0.09
97 0.1
98 0.09
99 0.09
100 0.09
101 0.09
102 0.12
103 0.13
104 0.14
105 0.16
106 0.16
107 0.16
108 0.16
109 0.19
110 0.16
111 0.17
112 0.15
113 0.13
114 0.15
115 0.14
116 0.14
117 0.09
118 0.1
119 0.08
120 0.08
121 0.1
122 0.08
123 0.08
124 0.09
125 0.1
126 0.1
127 0.11
128 0.1
129 0.09
130 0.08
131 0.07
132 0.08
133 0.07
134 0.06
135 0.06
136 0.06
137 0.05
138 0.06
139 0.05
140 0.04
141 0.03
142 0.03
143 0.03
144 0.04
145 0.04
146 0.03
147 0.03
148 0.03
149 0.03
150 0.04
151 0.03
152 0.03
153 0.04
154 0.04
155 0.05
156 0.05
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.06
163 0.05
164 0.05
165 0.04
166 0.03
167 0.02
168 0.02
169 0.02
170 0.01
171 0.01
172 0.01
173 0.01
174 0.01
175 0.02
176 0.02
177 0.02
178 0.03
179 0.03
180 0.04
181 0.04
182 0.05
183 0.07
184 0.09
185 0.1
186 0.12
187 0.16
188 0.24
189 0.28
190 0.29
191 0.28
192 0.29
193 0.31
194 0.31
195 0.34
196 0.33
197 0.33
198 0.38
199 0.39
200 0.38
201 0.35
202 0.33
203 0.27
204 0.21
205 0.19
206 0.14
207 0.11
208 0.1
209 0.1
210 0.11
211 0.11
212 0.11
213 0.08
214 0.08
215 0.09
216 0.1
217 0.1
218 0.08
219 0.07
220 0.09
221 0.1
222 0.1
223 0.09
224 0.1
225 0.16
226 0.17
227 0.19
228 0.16
229 0.18
230 0.18
231 0.21
232 0.27
233 0.22
234 0.22
235 0.21
236 0.24
237 0.21
238 0.22
239 0.19
240 0.13
241 0.13
242 0.15
243 0.15
244 0.12
245 0.12
246 0.11
247 0.13
248 0.13
249 0.12
250 0.12
251 0.12
252 0.13
253 0.14
254 0.13
255 0.13
256 0.11
257 0.1
258 0.1
259 0.09
260 0.09
261 0.08
262 0.07
263 0.06
264 0.06
265 0.06
266 0.05
267 0.07
268 0.07
269 0.1
270 0.13
271 0.13
272 0.13
273 0.13
274 0.14
275 0.15
276 0.16
277 0.14
278 0.14
279 0.15
280 0.15
281 0.16
282 0.17
283 0.16
284 0.14
285 0.16
286 0.16
287 0.15
288 0.16
289 0.16
290 0.14
291 0.14
292 0.14
293 0.11
294 0.11
295 0.11
296 0.11
297 0.12
298 0.12
299 0.12
300 0.1
301 0.11
302 0.07
303 0.07
304 0.07
305 0.07
306 0.07
307 0.07
308 0.08
309 0.08
310 0.09
311 0.09
312 0.09
313 0.09
314 0.11
315 0.12
316 0.12
317 0.16
318 0.16
319 0.15
320 0.15
321 0.14
322 0.13
323 0.13
324 0.15
325 0.12
326 0.19
327 0.26
328 0.29
329 0.36
330 0.44
331 0.5
332 0.55
333 0.65
334 0.69
335 0.74
336 0.81
337 0.83
338 0.85
339 0.89
340 0.85
341 0.83
342 0.79
343 0.69
344 0.67
345 0.61
346 0.53
347 0.44
348 0.39
349 0.31
350 0.24
351 0.23
352 0.17
353 0.16
354 0.16
355 0.15
356 0.15
357 0.15
358 0.14
359 0.14
360 0.11
361 0.09
362 0.08
363 0.07
364 0.06
365 0.06
366 0.06
367 0.06
368 0.06
369 0.07
370 0.09