Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395IJJ1

Protein Details
Accession A0A395IJJ1    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
51-71PTPKPNTSNTTKKPKNLRRRSHydrophilic
NLS Segment(s)
PositionSequence
17-71EKGKGSGEGAGTGTGEGKWPGKAAGKRKASSSPEPTPKPNTSNTTKKPKNLRRRS
Subcellular Location(s) mito 16, nucl 9, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MATRSAVAKAAAGGKDEKGKGSGEGAGTGTGEGKWPGKAAGKRKASSSPEPTPKPNTSNTTKKPKNLRRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.24
3 0.24
4 0.23
5 0.19
6 0.19
7 0.18
8 0.18
9 0.18
10 0.13
11 0.13
12 0.12
13 0.11
14 0.1
15 0.09
16 0.08
17 0.06
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.08
24 0.13
25 0.18
26 0.25
27 0.33
28 0.39
29 0.4
30 0.43
31 0.49
32 0.49
33 0.53
34 0.53
35 0.53
36 0.55
37 0.58
38 0.6
39 0.6
40 0.58
41 0.54
42 0.53
43 0.51
44 0.5
45 0.57
46 0.61
47 0.65
48 0.67
49 0.72
50 0.76
51 0.8