Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395J415

Protein Details
Accession A0A395J415    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
106-130PLPQRSTPSKSKSPRQFPHSEKRAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008721  ORC6  
Gene Ontology GO:0005664  C:nuclear origin of replication recognition complex  
GO:0003677  F:DNA binding  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF05460  ORC6  
Amino Acid Sequences MEFRCSLNQEQEIGRTYACANLACERLKTTLNLPKIEPRPPVPPRVYKKLYAYIEDSLASATPRKRARVEGNDSGNATPSRKSSLAQRPQKRTPGRNDTPIKMILPLPQRSTPSKSKSPRQFPHSEKRAPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.2
3 0.18
4 0.18
5 0.18
6 0.16
7 0.15
8 0.18
9 0.22
10 0.22
11 0.22
12 0.22
13 0.22
14 0.23
15 0.22
16 0.25
17 0.29
18 0.32
19 0.33
20 0.33
21 0.39
22 0.42
23 0.45
24 0.42
25 0.38
26 0.43
27 0.44
28 0.5
29 0.47
30 0.52
31 0.54
32 0.6
33 0.6
34 0.54
35 0.56
36 0.56
37 0.52
38 0.46
39 0.42
40 0.34
41 0.31
42 0.27
43 0.22
44 0.14
45 0.12
46 0.1
47 0.1
48 0.09
49 0.15
50 0.17
51 0.2
52 0.22
53 0.27
54 0.34
55 0.4
56 0.46
57 0.47
58 0.48
59 0.46
60 0.46
61 0.4
62 0.35
63 0.27
64 0.21
65 0.15
66 0.12
67 0.15
68 0.15
69 0.16
70 0.23
71 0.33
72 0.42
73 0.51
74 0.59
75 0.63
76 0.69
77 0.78
78 0.77
79 0.74
80 0.74
81 0.74
82 0.71
83 0.73
84 0.72
85 0.65
86 0.61
87 0.56
88 0.46
89 0.38
90 0.33
91 0.29
92 0.31
93 0.32
94 0.33
95 0.35
96 0.38
97 0.41
98 0.47
99 0.49
100 0.49
101 0.55
102 0.59
103 0.66
104 0.72
105 0.78
106 0.81
107 0.8
108 0.83
109 0.81
110 0.84
111 0.82