Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2M3U2

Protein Details
Accession E2M3U2    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
51-73DKLTKEKEAKKQTANQKKKDKKRBasic
NLS Segment(s)
PositionSequence
56-73EKEAKKQTANQKKKDKKR
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 4
Family & Domain DBs
KEGG mpr:MPER_14927  -  
Amino Acid Sequences VMTEEQKMEEGKRMFSIFAARMFEQRVLQAYREKVAQERQLQLLRELEDEDKLTKEKEAKKQTANQKKKDKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.26
4 0.2
5 0.22
6 0.24
7 0.21
8 0.22
9 0.24
10 0.24
11 0.2
12 0.18
13 0.19
14 0.16
15 0.18
16 0.2
17 0.2
18 0.19
19 0.2
20 0.19
21 0.18
22 0.22
23 0.26
24 0.25
25 0.26
26 0.29
27 0.31
28 0.31
29 0.3
30 0.28
31 0.22
32 0.19
33 0.19
34 0.16
35 0.14
36 0.14
37 0.14
38 0.13
39 0.13
40 0.13
41 0.15
42 0.22
43 0.29
44 0.38
45 0.47
46 0.52
47 0.58
48 0.66
49 0.74
50 0.78
51 0.8
52 0.8
53 0.82