Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R700

Protein Details
Accession A0A2Z6R700    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MNECYVCKKSSKTRCNKCHTTYYCSIECQKKDWKEHKKPCRILSINHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, mito_nucl 12.166, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS01360  ZF_MYND_1  
PS50865  ZF_MYND_2  
Amino Acid Sequences MNECYVCKKSSKTRCNKCHTTYYCSIECQKKDWKEHKKPCRILSINKIFDETVDEESFDNMLHQLLMNANYSMEDLKIPNFGEEYAMKYSHEKEQIQFLNRAKLSLNGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.87
3 0.89
4 0.84
5 0.84
6 0.78
7 0.76
8 0.72
9 0.68
10 0.6
11 0.54
12 0.56
13 0.52
14 0.49
15 0.45
16 0.47
17 0.47
18 0.55
19 0.62
20 0.66
21 0.69
22 0.79
23 0.84
24 0.86
25 0.86
26 0.81
27 0.81
28 0.74
29 0.7
30 0.7
31 0.69
32 0.62
33 0.55
34 0.52
35 0.41
36 0.36
37 0.33
38 0.24
39 0.17
40 0.13
41 0.14
42 0.13
43 0.13
44 0.13
45 0.09
46 0.08
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.05
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.08
59 0.07
60 0.07
61 0.07
62 0.06
63 0.07
64 0.1
65 0.1
66 0.1
67 0.1
68 0.1
69 0.12
70 0.12
71 0.15
72 0.15
73 0.16
74 0.16
75 0.18
76 0.2
77 0.24
78 0.31
79 0.29
80 0.28
81 0.37
82 0.43
83 0.45
84 0.49
85 0.46
86 0.49
87 0.47
88 0.46
89 0.38