Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QQK2

Protein Details
Accession A0A2Z6QQK2    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
57-95NNDNGEKRNKRKRKGESSENNRRKRSRQSSNIRKKSDKIBasic
NLS Segment(s)
PositionSequence
63-91KRNKRKRKGESSENNRRKRSRQSSNIRKK
Subcellular Location(s) nucl 24, cyto_nucl 14.333, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MLEKQGGESNENKENEDLENINEENVIEKVNDEKNDTKNRKENDIEVNIENNENDENNDNGEKRNKRKRKGESSENNRRKRSRQSSNIRKKSDKIIDEEDNDKNDGESNSKEKENEYETLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.27
4 0.23
5 0.17
6 0.2
7 0.18
8 0.17
9 0.16
10 0.14
11 0.12
12 0.11
13 0.11
14 0.07
15 0.07
16 0.11
17 0.15
18 0.17
19 0.2
20 0.24
21 0.31
22 0.41
23 0.45
24 0.48
25 0.52
26 0.53
27 0.56
28 0.53
29 0.5
30 0.47
31 0.47
32 0.44
33 0.37
34 0.36
35 0.29
36 0.27
37 0.22
38 0.15
39 0.11
40 0.08
41 0.08
42 0.08
43 0.08
44 0.09
45 0.1
46 0.1
47 0.11
48 0.19
49 0.24
50 0.31
51 0.42
52 0.49
53 0.56
54 0.66
55 0.74
56 0.78
57 0.81
58 0.83
59 0.83
60 0.84
61 0.88
62 0.88
63 0.86
64 0.81
65 0.77
66 0.72
67 0.72
68 0.72
69 0.71
70 0.72
71 0.76
72 0.8
73 0.87
74 0.91
75 0.87
76 0.81
77 0.74
78 0.73
79 0.71
80 0.63
81 0.58
82 0.55
83 0.53
84 0.53
85 0.54
86 0.47
87 0.41
88 0.38
89 0.31
90 0.25
91 0.23
92 0.2
93 0.2
94 0.21
95 0.23
96 0.27
97 0.29
98 0.3
99 0.29
100 0.33
101 0.34