Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QCY1

Protein Details
Accession A0A2Z6QCY1    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-44ASSSSSSHHHRKKKHSSKINRKKVDDAHydrophilic
NLS Segment(s)
PositionSequence
27-40HRKKKHSSKINRKK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007330  MIT_dom  
IPR036181  MIT_dom_sf  
Pfam View protein in Pfam  
PF04212  MIT  
Amino Acid Sequences MGNSNSASVQPSSKTTSASSSSSSHHHRKKKHSSKINRKKVDDAITLSAFAVEEDNQGNHDVAIGYYLSAIENMLEALPIHSNQSERTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.26
4 0.27
5 0.27
6 0.27
7 0.24
8 0.25
9 0.28
10 0.34
11 0.39
12 0.45
13 0.51
14 0.56
15 0.64
16 0.74
17 0.79
18 0.82
19 0.83
20 0.86
21 0.9
22 0.93
23 0.93
24 0.89
25 0.81
26 0.76
27 0.71
28 0.65
29 0.56
30 0.48
31 0.4
32 0.32
33 0.3
34 0.24
35 0.18
36 0.13
37 0.1
38 0.08
39 0.05
40 0.05
41 0.06
42 0.06
43 0.07
44 0.08
45 0.08
46 0.07
47 0.07
48 0.06
49 0.06
50 0.07
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.06
65 0.08
66 0.08
67 0.11
68 0.12
69 0.14