Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QPE7

Protein Details
Accession A0A2Z6QPE7    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-74GWLNNFKKRHNIKQYNKHGEAKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 12, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004875  DDE_SF_endonuclease_dom  
IPR006600  HTH_CenpB_DNA-bd_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03184  DDE_1  
PF03221  HTH_Tnp_Tc5  
Amino Acid Sequences MISYIIEKCGEKKELCLLHQENPSLSQEEIGKKFGPKLLILRNIEGFTGSAGWLNNFKKRHNIKQYNKHGEAKSGPGEEELAKEREKLRELISNFDLEDVFNCDETGLYWELEPSKTLSTGPLSGTKKSKNRVTLLLTFNVTGSIKLPALFIHKHQTPRDLKGIDKTKLPVDYFWNKSAWMQTSIWNKYLELLNQRMKRQNRKILLLVDNAPVHSVSNPELLTNITIHYLPPNTTAHLQPADAGIINSFKVCILFIIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.47
4 0.44
5 0.45
6 0.5
7 0.49
8 0.41
9 0.38
10 0.4
11 0.32
12 0.29
13 0.24
14 0.24
15 0.29
16 0.3
17 0.3
18 0.29
19 0.29
20 0.32
21 0.33
22 0.3
23 0.26
24 0.31
25 0.36
26 0.43
27 0.43
28 0.43
29 0.43
30 0.41
31 0.38
32 0.31
33 0.23
34 0.14
35 0.13
36 0.1
37 0.09
38 0.08
39 0.09
40 0.15
41 0.18
42 0.24
43 0.26
44 0.28
45 0.36
46 0.44
47 0.54
48 0.59
49 0.67
50 0.71
51 0.8
52 0.89
53 0.89
54 0.86
55 0.83
56 0.73
57 0.66
58 0.58
59 0.52
60 0.45
61 0.36
62 0.3
63 0.23
64 0.24
65 0.19
66 0.19
67 0.18
68 0.16
69 0.15
70 0.17
71 0.19
72 0.22
73 0.24
74 0.23
75 0.22
76 0.27
77 0.28
78 0.31
79 0.29
80 0.26
81 0.24
82 0.22
83 0.2
84 0.13
85 0.12
86 0.11
87 0.1
88 0.09
89 0.09
90 0.08
91 0.08
92 0.09
93 0.11
94 0.08
95 0.07
96 0.07
97 0.08
98 0.09
99 0.1
100 0.1
101 0.09
102 0.08
103 0.08
104 0.08
105 0.09
106 0.09
107 0.11
108 0.11
109 0.17
110 0.19
111 0.21
112 0.25
113 0.3
114 0.33
115 0.38
116 0.42
117 0.4
118 0.41
119 0.43
120 0.44
121 0.45
122 0.42
123 0.39
124 0.34
125 0.29
126 0.26
127 0.22
128 0.17
129 0.1
130 0.08
131 0.08
132 0.07
133 0.08
134 0.08
135 0.07
136 0.11
137 0.12
138 0.13
139 0.18
140 0.22
141 0.27
142 0.28
143 0.36
144 0.36
145 0.39
146 0.44
147 0.39
148 0.36
149 0.4
150 0.47
151 0.39
152 0.38
153 0.36
154 0.32
155 0.35
156 0.34
157 0.27
158 0.27
159 0.33
160 0.35
161 0.35
162 0.32
163 0.29
164 0.29
165 0.31
166 0.27
167 0.23
168 0.2
169 0.25
170 0.33
171 0.35
172 0.37
173 0.33
174 0.31
175 0.29
176 0.31
177 0.28
178 0.25
179 0.29
180 0.35
181 0.39
182 0.45
183 0.5
184 0.56
185 0.63
186 0.67
187 0.71
188 0.69
189 0.69
190 0.69
191 0.68
192 0.64
193 0.57
194 0.5
195 0.45
196 0.39
197 0.33
198 0.28
199 0.21
200 0.18
201 0.14
202 0.13
203 0.11
204 0.14
205 0.14
206 0.13
207 0.14
208 0.14
209 0.15
210 0.13
211 0.12
212 0.1
213 0.1
214 0.1
215 0.14
216 0.15
217 0.15
218 0.18
219 0.19
220 0.21
221 0.23
222 0.25
223 0.26
224 0.26
225 0.25
226 0.22
227 0.22
228 0.2
229 0.18
230 0.16
231 0.12
232 0.12
233 0.12
234 0.11
235 0.1
236 0.09
237 0.09
238 0.09