Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R3K1

Protein Details
Accession A0A2Z6R3K1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
332-353TIDSIRRKYKLNKRQLLRCLEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
IPR019467  Hat1_N  
IPR037113  Hat1_N_sf  
IPR017380  Hist_AcTrfase_B-typ_cat-su  
IPR013523  Hist_AcTrfase_HAT1_C  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0004402  F:histone acetyltransferase activity  
GO:0042393  F:histone binding  
GO:0016573  P:histone acetylation  
GO:0031509  P:subtelomeric heterochromatin formation  
Pfam View protein in Pfam  
PF00583  Acetyltransf_1  
PF10394  Hat1_N  
Amino Acid Sequences MTEMVLKPQEEEWLCNSNEALTIWFLEPSTDPDREFDSVQVFPMFTYSIFGDKEQIYGYKDLEITLKFSSGSFATYFDVRYSDKIPDVSSTSIADNVVDKIKALIPNDYITNYDAFLQTVHEDAYSFKPMGEKITEYRLEEGDDVIYEIYRATFETPRFKEYHKRFQIMILFYIEAGTYIDEDEKWETMLSFEKKRIGDKYTYSFMGFCTMYNYYFYNREKCVNTENCVVIDQINNNKVPISERVNEGKVIPEDIRLRISQFLIFPHVQGKGHGSKLYQTIYKYVLSNSRIKELAVEIPNDSFEAIRDKNDLLYIREQKIFEGLVAPVDKNTIDSIRRKYKLNKRQLLRCLEIELLRKLNKSDAAAYKAYRLQVKERLYNWNKEILKDVDRAERIEKLEETFKGLVEEYQEILLKYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.31
4 0.23
5 0.23
6 0.21
7 0.17
8 0.12
9 0.14
10 0.14
11 0.14
12 0.13
13 0.13
14 0.13
15 0.18
16 0.22
17 0.21
18 0.22
19 0.23
20 0.27
21 0.28
22 0.28
23 0.24
24 0.23
25 0.21
26 0.23
27 0.22
28 0.18
29 0.16
30 0.16
31 0.14
32 0.1
33 0.12
34 0.11
35 0.13
36 0.14
37 0.15
38 0.18
39 0.18
40 0.19
41 0.18
42 0.2
43 0.19
44 0.2
45 0.2
46 0.19
47 0.19
48 0.19
49 0.21
50 0.19
51 0.19
52 0.17
53 0.17
54 0.14
55 0.14
56 0.15
57 0.12
58 0.14
59 0.11
60 0.12
61 0.13
62 0.14
63 0.15
64 0.13
65 0.16
66 0.15
67 0.17
68 0.18
69 0.19
70 0.2
71 0.21
72 0.21
73 0.21
74 0.23
75 0.22
76 0.21
77 0.19
78 0.17
79 0.17
80 0.16
81 0.14
82 0.12
83 0.12
84 0.13
85 0.11
86 0.11
87 0.11
88 0.15
89 0.18
90 0.18
91 0.19
92 0.18
93 0.2
94 0.21
95 0.2
96 0.18
97 0.16
98 0.16
99 0.13
100 0.12
101 0.11
102 0.1
103 0.09
104 0.09
105 0.09
106 0.09
107 0.09
108 0.07
109 0.07
110 0.09
111 0.12
112 0.14
113 0.13
114 0.13
115 0.15
116 0.15
117 0.18
118 0.18
119 0.17
120 0.16
121 0.23
122 0.25
123 0.24
124 0.26
125 0.23
126 0.22
127 0.2
128 0.19
129 0.12
130 0.1
131 0.09
132 0.07
133 0.06
134 0.05
135 0.05
136 0.04
137 0.04
138 0.05
139 0.07
140 0.11
141 0.14
142 0.23
143 0.25
144 0.29
145 0.3
146 0.33
147 0.4
148 0.44
149 0.53
150 0.5
151 0.51
152 0.48
153 0.51
154 0.54
155 0.46
156 0.4
157 0.3
158 0.23
159 0.2
160 0.2
161 0.15
162 0.09
163 0.07
164 0.05
165 0.04
166 0.04
167 0.05
168 0.04
169 0.06
170 0.07
171 0.06
172 0.07
173 0.06
174 0.06
175 0.07
176 0.13
177 0.15
178 0.16
179 0.18
180 0.23
181 0.23
182 0.26
183 0.29
184 0.27
185 0.27
186 0.28
187 0.31
188 0.29
189 0.29
190 0.26
191 0.23
192 0.19
193 0.19
194 0.15
195 0.11
196 0.11
197 0.11
198 0.11
199 0.12
200 0.13
201 0.12
202 0.17
203 0.19
204 0.21
205 0.21
206 0.25
207 0.25
208 0.26
209 0.33
210 0.3
211 0.32
212 0.31
213 0.3
214 0.27
215 0.26
216 0.24
217 0.16
218 0.15
219 0.14
220 0.15
221 0.17
222 0.16
223 0.16
224 0.16
225 0.15
226 0.16
227 0.18
228 0.19
229 0.18
230 0.22
231 0.25
232 0.26
233 0.26
234 0.24
235 0.24
236 0.19
237 0.19
238 0.16
239 0.16
240 0.17
241 0.18
242 0.2
243 0.17
244 0.17
245 0.17
246 0.18
247 0.15
248 0.14
249 0.14
250 0.17
251 0.17
252 0.16
253 0.17
254 0.18
255 0.16
256 0.16
257 0.2
258 0.19
259 0.21
260 0.22
261 0.2
262 0.21
263 0.25
264 0.27
265 0.24
266 0.21
267 0.22
268 0.23
269 0.24
270 0.22
271 0.2
272 0.24
273 0.25
274 0.31
275 0.29
276 0.31
277 0.29
278 0.28
279 0.28
280 0.23
281 0.27
282 0.23
283 0.23
284 0.2
285 0.2
286 0.2
287 0.19
288 0.17
289 0.09
290 0.08
291 0.13
292 0.13
293 0.14
294 0.15
295 0.16
296 0.16
297 0.2
298 0.21
299 0.19
300 0.27
301 0.32
302 0.33
303 0.37
304 0.36
305 0.33
306 0.34
307 0.3
308 0.22
309 0.17
310 0.13
311 0.13
312 0.14
313 0.14
314 0.12
315 0.13
316 0.12
317 0.11
318 0.13
319 0.14
320 0.17
321 0.24
322 0.33
323 0.42
324 0.45
325 0.5
326 0.59
327 0.66
328 0.71
329 0.76
330 0.77
331 0.75
332 0.82
333 0.85
334 0.83
335 0.76
336 0.67
337 0.59
338 0.53
339 0.49
340 0.44
341 0.4
342 0.37
343 0.35
344 0.35
345 0.33
346 0.34
347 0.33
348 0.31
349 0.35
350 0.35
351 0.37
352 0.39
353 0.39
354 0.39
355 0.39
356 0.4
357 0.38
358 0.35
359 0.37
360 0.42
361 0.48
362 0.5
363 0.5
364 0.58
365 0.59
366 0.64
367 0.59
368 0.6
369 0.55
370 0.49
371 0.52
372 0.46
373 0.45
374 0.41
375 0.42
376 0.42
377 0.42
378 0.44
379 0.4
380 0.4
381 0.38
382 0.38
383 0.36
384 0.31
385 0.35
386 0.33
387 0.37
388 0.32
389 0.3
390 0.27
391 0.26
392 0.24
393 0.21
394 0.22
395 0.17
396 0.18
397 0.2