Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RXL1

Protein Details
Accession A0A2Z6RXL1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
38-64VMPLTKSQKRSAKKKARKEEQKLQLQTHydrophilic
NLS Segment(s)
PositionSequence
45-55QKRSAKKKARK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MHQSDASMNFDVLDTKLIGSLDDKLLATPPHNITPIPVMPLTKSQKRSAKKKARKEEQKLQLQTPSGLDEHIVPTFSTGSPEYTPSKPSGSRTVTFNQSTLSPPSTPYKQQLSEIPNHNQLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.1
5 0.1
6 0.1
7 0.12
8 0.12
9 0.13
10 0.13
11 0.11
12 0.14
13 0.14
14 0.14
15 0.17
16 0.19
17 0.2
18 0.21
19 0.21
20 0.2
21 0.23
22 0.23
23 0.2
24 0.18
25 0.15
26 0.16
27 0.24
28 0.29
29 0.3
30 0.34
31 0.38
32 0.46
33 0.53
34 0.62
35 0.65
36 0.7
37 0.73
38 0.8
39 0.84
40 0.87
41 0.89
42 0.88
43 0.87
44 0.85
45 0.85
46 0.77
47 0.68
48 0.59
49 0.49
50 0.41
51 0.31
52 0.24
53 0.14
54 0.11
55 0.1
56 0.08
57 0.09
58 0.09
59 0.08
60 0.07
61 0.07
62 0.09
63 0.08
64 0.1
65 0.09
66 0.11
67 0.11
68 0.15
69 0.18
70 0.18
71 0.2
72 0.2
73 0.23
74 0.23
75 0.26
76 0.32
77 0.33
78 0.34
79 0.36
80 0.39
81 0.42
82 0.41
83 0.38
84 0.3
85 0.26
86 0.27
87 0.27
88 0.25
89 0.19
90 0.21
91 0.27
92 0.31
93 0.34
94 0.37
95 0.41
96 0.4
97 0.43
98 0.48
99 0.47
100 0.5
101 0.53
102 0.53