Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RWX2

Protein Details
Accession A0A2Z6RWX2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
68-116SSKLSKKDKKTVPSKTRPTKSNKPAKDTKKTSKKLKDKKKSKKSSDKKPBasic
NLS Segment(s)
PositionSequence
70-116KLSKKDKKTVPSKTRPTKSNKPAKDTKKTSKKLKDKKKSKKSSDKKP
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 6.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSTTCLKTQSCKSSIVAFFEKFEDVEACRQTIFNFNHHDQDYSHPWCKAPSSANSKVFTNKSKSSSISSKLSKKDKKTVPSKTRPTKSNKPAKDTKKTSKKLKDKKKSKKSSDKKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.44
4 0.36
5 0.35
6 0.33
7 0.32
8 0.23
9 0.22
10 0.17
11 0.14
12 0.18
13 0.18
14 0.17
15 0.17
16 0.17
17 0.16
18 0.23
19 0.23
20 0.23
21 0.28
22 0.3
23 0.35
24 0.35
25 0.35
26 0.28
27 0.31
28 0.33
29 0.33
30 0.34
31 0.29
32 0.29
33 0.28
34 0.29
35 0.26
36 0.23
37 0.24
38 0.3
39 0.36
40 0.41
41 0.41
42 0.41
43 0.42
44 0.41
45 0.38
46 0.35
47 0.32
48 0.3
49 0.31
50 0.32
51 0.33
52 0.34
53 0.35
54 0.35
55 0.37
56 0.4
57 0.45
58 0.53
59 0.55
60 0.57
61 0.62
62 0.63
63 0.66
64 0.7
65 0.74
66 0.75
67 0.78
68 0.83
69 0.84
70 0.84
71 0.82
72 0.81
73 0.81
74 0.81
75 0.81
76 0.77
77 0.75
78 0.78
79 0.8
80 0.82
81 0.8
82 0.81
83 0.81
84 0.84
85 0.86
86 0.87
87 0.89
88 0.89
89 0.91
90 0.91
91 0.92
92 0.94
93 0.95
94 0.95
95 0.95
96 0.96