Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R7V6

Protein Details
Accession A0A2Z6R7V6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
86-114DYHWTRPTFTTPKKKKGDKPSSAKDSQKAHydrophilic
NLS Segment(s)
PositionSequence
98-105KKKKGDKP
Subcellular Location(s) nucl 15.5, cyto_nucl 11.833, cyto 7, cyto_pero 4.333
Family & Domain DBs
Amino Acid Sequences MDVEMNNNENPNKHPNQNSNEGFNENPNENPNKNPNESPETNDLEESDDDEDLTNLEKEFWLIAYFKTYDDLKMALETCFYLDGQDYHWTRPTFTTPKKKKGDKPSSAKDSQKATHWSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.55
4 0.63
5 0.62
6 0.59
7 0.56
8 0.51
9 0.44
10 0.39
11 0.36
12 0.28
13 0.26
14 0.26
15 0.28
16 0.26
17 0.3
18 0.34
19 0.36
20 0.38
21 0.39
22 0.39
23 0.42
24 0.42
25 0.42
26 0.4
27 0.38
28 0.35
29 0.33
30 0.28
31 0.23
32 0.21
33 0.18
34 0.13
35 0.09
36 0.08
37 0.08
38 0.08
39 0.06
40 0.07
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.08
52 0.08
53 0.08
54 0.11
55 0.11
56 0.1
57 0.11
58 0.11
59 0.09
60 0.1
61 0.11
62 0.08
63 0.08
64 0.08
65 0.08
66 0.08
67 0.07
68 0.07
69 0.07
70 0.07
71 0.09
72 0.16
73 0.17
74 0.18
75 0.25
76 0.25
77 0.25
78 0.28
79 0.33
80 0.35
81 0.44
82 0.53
83 0.56
84 0.66
85 0.75
86 0.81
87 0.83
88 0.85
89 0.87
90 0.86
91 0.87
92 0.87
93 0.86
94 0.85
95 0.81
96 0.75
97 0.72
98 0.64
99 0.62