Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RZY4

Protein Details
Accession A0A2Z6RZY4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
117-143AILKKMLRRRSRVWWHKKKSITNDIFFHydrophilic
NLS Segment(s)
PositionSequence
124-129RRRSRV
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MFCNTISAWSRDAKPIALIVKHLFKVYVWGAISVKGKIGMHMFIENLDRHLYRQILNEHLHDNANAMHGRRWVFQQVNDPKHTSRDVKSDLETYLPGRVLPWPSYSPDLNPIENVWAILKKMLRRRSRVWWHKKKSITNDIFFALIRKEWDDLDNNVIVNCINSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.3
4 0.26
5 0.27
6 0.26
7 0.3
8 0.3
9 0.29
10 0.25
11 0.2
12 0.25
13 0.23
14 0.23
15 0.18
16 0.19
17 0.19
18 0.23
19 0.25
20 0.2
21 0.19
22 0.17
23 0.17
24 0.17
25 0.18
26 0.15
27 0.15
28 0.15
29 0.15
30 0.13
31 0.16
32 0.14
33 0.14
34 0.15
35 0.13
36 0.13
37 0.16
38 0.17
39 0.16
40 0.2
41 0.22
42 0.25
43 0.26
44 0.27
45 0.25
46 0.25
47 0.24
48 0.19
49 0.17
50 0.12
51 0.13
52 0.12
53 0.12
54 0.12
55 0.14
56 0.16
57 0.16
58 0.17
59 0.2
60 0.2
61 0.22
62 0.3
63 0.36
64 0.39
65 0.4
66 0.4
67 0.35
68 0.37
69 0.38
70 0.31
71 0.25
72 0.26
73 0.28
74 0.27
75 0.28
76 0.27
77 0.25
78 0.22
79 0.21
80 0.15
81 0.13
82 0.11
83 0.1
84 0.09
85 0.11
86 0.12
87 0.13
88 0.15
89 0.15
90 0.17
91 0.2
92 0.21
93 0.19
94 0.24
95 0.25
96 0.23
97 0.22
98 0.2
99 0.19
100 0.18
101 0.18
102 0.11
103 0.1
104 0.1
105 0.12
106 0.15
107 0.18
108 0.27
109 0.35
110 0.42
111 0.48
112 0.53
113 0.61
114 0.69
115 0.75
116 0.78
117 0.8
118 0.82
119 0.84
120 0.87
121 0.85
122 0.83
123 0.84
124 0.8
125 0.72
126 0.66
127 0.58
128 0.5
129 0.42
130 0.34
131 0.24
132 0.18
133 0.17
134 0.16
135 0.16
136 0.16
137 0.2
138 0.22
139 0.23
140 0.25
141 0.25
142 0.23
143 0.22
144 0.21
145 0.17