Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RA03

Protein Details
Accession A0A2Z6RA03    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
65-90NDSQAPKKPSKRHHSSKSKISKRDLYHydrophilic
NLS Segment(s)
PositionSequence
69-86APKKPSKRHHSSKSKISK
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MILKKTKKISPTSSHSAKRKNQGDRVDTKSSTKPSKSIPATGSNKTHIRNPQMKNSKAHQRKDDNDSQAPKKPSKRHHSSKSKISKRDLYAEVRTIKKILDELTSNLKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.74
3 0.75
4 0.74
5 0.75
6 0.76
7 0.76
8 0.75
9 0.74
10 0.74
11 0.72
12 0.72
13 0.68
14 0.6
15 0.55
16 0.53
17 0.51
18 0.5
19 0.45
20 0.4
21 0.38
22 0.47
23 0.45
24 0.44
25 0.41
26 0.44
27 0.46
28 0.48
29 0.46
30 0.41
31 0.42
32 0.38
33 0.4
34 0.36
35 0.39
36 0.43
37 0.44
38 0.5
39 0.55
40 0.57
41 0.55
42 0.55
43 0.58
44 0.57
45 0.6
46 0.58
47 0.57
48 0.58
49 0.61
50 0.64
51 0.59
52 0.57
53 0.57
54 0.53
55 0.52
56 0.52
57 0.5
58 0.51
59 0.53
60 0.57
61 0.62
62 0.69
63 0.72
64 0.79
65 0.84
66 0.83
67 0.86
68 0.87
69 0.86
70 0.83
71 0.8
72 0.78
73 0.71
74 0.71
75 0.66
76 0.61
77 0.57
78 0.56
79 0.55
80 0.49
81 0.46
82 0.39
83 0.35
84 0.3
85 0.28
86 0.23
87 0.22
88 0.22
89 0.24
90 0.32