Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QTH3

Protein Details
Accession A0A2Z6QTH3    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
107-128GAKEECRKKRIRDYMQKSKKMNBasic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039577  Rad18  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0003697  F:single-stranded DNA binding  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0006301  P:postreplication repair  
GO:0006513  P:protein monoubiquitination  
Pfam View protein in Pfam  
PF13923  zf-C3HC4_2  
PROSITE View protein in PROSITE  
PS00518  ZF_RING_1  
PS50089  ZF_RING_2  
Amino Acid Sequences MLTPPPSTSTSYISDNSITDPTEFSHKSLQSIDTVSRCPICKDFLNTPTVGECGHIYCSFCVLRTLAIERNCPICKTKLSDHQLFKSIATEKIVNCWKNIRETILRGAKEECRKKRIRDYMQKSKKMNSVRTTHLNPRNRYTSCTNGKNVGKLEYAYLHNSDLISSQSDYDEKLKFCIQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.24
4 0.22
5 0.19
6 0.16
7 0.15
8 0.15
9 0.21
10 0.21
11 0.21
12 0.27
13 0.27
14 0.28
15 0.3
16 0.3
17 0.24
18 0.26
19 0.28
20 0.23
21 0.24
22 0.24
23 0.25
24 0.24
25 0.25
26 0.24
27 0.25
28 0.26
29 0.3
30 0.35
31 0.35
32 0.38
33 0.35
34 0.34
35 0.3
36 0.27
37 0.21
38 0.15
39 0.12
40 0.09
41 0.12
42 0.12
43 0.12
44 0.11
45 0.14
46 0.14
47 0.13
48 0.14
49 0.11
50 0.11
51 0.11
52 0.14
53 0.16
54 0.18
55 0.2
56 0.2
57 0.25
58 0.25
59 0.25
60 0.24
61 0.22
62 0.22
63 0.26
64 0.29
65 0.34
66 0.39
67 0.46
68 0.47
69 0.47
70 0.48
71 0.43
72 0.38
73 0.32
74 0.27
75 0.2
76 0.18
77 0.18
78 0.14
79 0.19
80 0.25
81 0.22
82 0.21
83 0.25
84 0.24
85 0.26
86 0.27
87 0.25
88 0.22
89 0.24
90 0.32
91 0.33
92 0.32
93 0.29
94 0.31
95 0.33
96 0.4
97 0.47
98 0.45
99 0.48
100 0.53
101 0.58
102 0.66
103 0.71
104 0.72
105 0.74
106 0.78
107 0.81
108 0.85
109 0.87
110 0.79
111 0.74
112 0.7
113 0.67
114 0.65
115 0.61
116 0.56
117 0.54
118 0.58
119 0.59
120 0.62
121 0.63
122 0.64
123 0.61
124 0.62
125 0.65
126 0.58
127 0.58
128 0.54
129 0.55
130 0.55
131 0.57
132 0.53
133 0.54
134 0.55
135 0.55
136 0.51
137 0.44
138 0.37
139 0.31
140 0.3
141 0.26
142 0.26
143 0.24
144 0.23
145 0.21
146 0.2
147 0.19
148 0.18
149 0.15
150 0.14
151 0.13
152 0.13
153 0.13
154 0.14
155 0.14
156 0.17
157 0.2
158 0.23
159 0.22
160 0.25