Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QKP3

Protein Details
Accession A0A2Z6QKP3    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
46-73NLNNPNKQTRSKRRPKSTKRIKASYEKEHydrophilic
NLS Segment(s)
PositionSequence
54-68TRSKRRPKSTKRIKA
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MNNLQIYNLYILENYLKDVEEQNEQNENIELEDIDNGSDKENVPFNLNNPNKQTRSKRRPKSTKRIKASYEKEKATTSINSKQYKCENYGNMSHNKQNCNNLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.11
4 0.12
5 0.15
6 0.16
7 0.19
8 0.21
9 0.22
10 0.26
11 0.25
12 0.25
13 0.23
14 0.21
15 0.15
16 0.14
17 0.11
18 0.07
19 0.07
20 0.06
21 0.06
22 0.06
23 0.06
24 0.07
25 0.08
26 0.08
27 0.09
28 0.11
29 0.12
30 0.14
31 0.14
32 0.15
33 0.24
34 0.25
35 0.27
36 0.29
37 0.34
38 0.34
39 0.4
40 0.49
41 0.5
42 0.59
43 0.67
44 0.72
45 0.78
46 0.87
47 0.9
48 0.91
49 0.92
50 0.91
51 0.89
52 0.87
53 0.82
54 0.81
55 0.79
56 0.78
57 0.74
58 0.66
59 0.59
60 0.53
61 0.48
62 0.42
63 0.39
64 0.34
65 0.35
66 0.42
67 0.46
68 0.46
69 0.51
70 0.55
71 0.55
72 0.54
73 0.53
74 0.49
75 0.47
76 0.54
77 0.53
78 0.54
79 0.54
80 0.56
81 0.54
82 0.57
83 0.57