Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S3H0

Protein Details
Accession A0A2Z6S3H0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
41-67SSTNNKPEEKNKKNYNKKDKNTGTFPQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MIPDPAPKCTKVSLESQTRSPIIRFNCVFIRRPAKDSSQFSSTNNKPEEKNKKNYNKKDKNTGTFPQRSYLNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.46
4 0.47
5 0.44
6 0.42
7 0.36
8 0.33
9 0.26
10 0.31
11 0.29
12 0.28
13 0.33
14 0.35
15 0.36
16 0.37
17 0.43
18 0.37
19 0.4
20 0.39
21 0.38
22 0.42
23 0.43
24 0.41
25 0.37
26 0.36
27 0.34
28 0.4
29 0.37
30 0.37
31 0.36
32 0.35
33 0.33
34 0.42
35 0.51
36 0.5
37 0.58
38 0.61
39 0.7
40 0.78
41 0.87
42 0.89
43 0.88
44 0.87
45 0.89
46 0.88
47 0.85
48 0.81
49 0.79
50 0.78
51 0.74
52 0.69
53 0.63