Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SG34

Protein Details
Accession A0A2Z6SG34    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
79-106TGNSRTMLWRKNKERKKLNDDTKRMTRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MEETTRKIEAVEESKKETGNDIIEEWIEGKVVGDLTEGKAIKDWIKENLKEFKEVGNRLITEVLHWHDDVANSIRAVYTGNSRTMLWRKNKERKKLNDDTKRMTRLDTFFKSAKIKNFETLYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.39
4 0.34
5 0.3
6 0.26
7 0.24
8 0.2
9 0.19
10 0.18
11 0.18
12 0.16
13 0.12
14 0.09
15 0.07
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.06
22 0.08
23 0.13
24 0.13
25 0.12
26 0.13
27 0.14
28 0.16
29 0.18
30 0.19
31 0.22
32 0.28
33 0.29
34 0.33
35 0.4
36 0.38
37 0.37
38 0.36
39 0.33
40 0.34
41 0.33
42 0.31
43 0.25
44 0.24
45 0.23
46 0.23
47 0.17
48 0.12
49 0.12
50 0.12
51 0.1
52 0.09
53 0.09
54 0.09
55 0.09
56 0.11
57 0.11
58 0.11
59 0.1
60 0.1
61 0.1
62 0.09
63 0.1
64 0.09
65 0.12
66 0.13
67 0.14
68 0.16
69 0.16
70 0.21
71 0.27
72 0.33
73 0.37
74 0.45
75 0.54
76 0.63
77 0.72
78 0.77
79 0.81
80 0.84
81 0.85
82 0.85
83 0.86
84 0.86
85 0.85
86 0.83
87 0.82
88 0.77
89 0.68
90 0.6
91 0.55
92 0.49
93 0.51
94 0.47
95 0.44
96 0.41
97 0.45
98 0.49
99 0.48
100 0.51
101 0.5
102 0.48
103 0.49