Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S0U3

Protein Details
Accession A0A2Z6S0U3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MSRHKRSRCKRSKASKRRKNVLRSALRSBasic
NLS Segment(s)
PositionSequence
3-20RHKRSRCKRSKASKRRKN
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MSRHKRSRCKRSKASKRRKNVLRSALRSINYRMNKMKLEDPQSIMTTSQESDEHLIAAMDNISVQDPPSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.93
3 0.93
4 0.93
5 0.91
6 0.89
7 0.87
8 0.86
9 0.84
10 0.8
11 0.76
12 0.71
13 0.64
14 0.57
15 0.5
16 0.48
17 0.41
18 0.4
19 0.36
20 0.34
21 0.34
22 0.33
23 0.35
24 0.32
25 0.35
26 0.33
27 0.32
28 0.31
29 0.31
30 0.29
31 0.25
32 0.2
33 0.16
34 0.14
35 0.12
36 0.1
37 0.1
38 0.12
39 0.12
40 0.11
41 0.1
42 0.1
43 0.08
44 0.09
45 0.07
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06