Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RGM4

Protein Details
Accession A0A2Z6RGM4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-32NKRSNCSTITEKKRRHWNARKKIAIIHydrophilic
NLS Segment(s)
PositionSequence
19-27KRRHWNARK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007889  HTH_Psq  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF04218  CENP-B_N  
Amino Acid Sequences MGRPQANKRSNCSTITEKKRRHWNARKKIAIIMYHENGHSKNKTVAKFNIQTNQLRNWISKKPQLLKVQPGVKRLNTGAKPKYPALETALLTWIKEKRKNQNAVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.67
4 0.65
5 0.7
6 0.78
7 0.82
8 0.84
9 0.85
10 0.85
11 0.86
12 0.9
13 0.88
14 0.78
15 0.74
16 0.68
17 0.6
18 0.54
19 0.49
20 0.41
21 0.36
22 0.34
23 0.3
24 0.26
25 0.28
26 0.23
27 0.19
28 0.23
29 0.27
30 0.29
31 0.33
32 0.35
33 0.37
34 0.41
35 0.41
36 0.41
37 0.39
38 0.39
39 0.37
40 0.36
41 0.33
42 0.29
43 0.28
44 0.26
45 0.28
46 0.3
47 0.32
48 0.36
49 0.38
50 0.45
51 0.51
52 0.52
53 0.53
54 0.56
55 0.6
56 0.56
57 0.56
58 0.52
59 0.45
60 0.43
61 0.39
62 0.4
63 0.38
64 0.43
65 0.44
66 0.44
67 0.48
68 0.47
69 0.48
70 0.4
71 0.37
72 0.34
73 0.33
74 0.28
75 0.26
76 0.29
77 0.26
78 0.24
79 0.27
80 0.27
81 0.3
82 0.38
83 0.44
84 0.5
85 0.6