Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QNF9

Protein Details
Accession A0A2Z6QNF9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
40-60RDEERRTKKNKFQKNKLELEQBasic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR031568  Pet117  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF15786  PET117  
Amino Acid Sequences MSRTAKFTLIAAIFISTGTVWGVHHLQKKEKEFMHAGILRDEERRTKKNKFQKNKLELEQQLILQREYEKIQPVKRNDNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.06
4 0.06
5 0.05
6 0.05
7 0.05
8 0.07
9 0.1
10 0.15
11 0.21
12 0.24
13 0.3
14 0.36
15 0.41
16 0.45
17 0.43
18 0.42
19 0.39
20 0.37
21 0.38
22 0.35
23 0.31
24 0.26
25 0.26
26 0.22
27 0.21
28 0.21
29 0.2
30 0.22
31 0.27
32 0.31
33 0.38
34 0.46
35 0.55
36 0.65
37 0.69
38 0.74
39 0.8
40 0.83
41 0.83
42 0.79
43 0.78
44 0.69
45 0.63
46 0.54
47 0.45
48 0.41
49 0.35
50 0.3
51 0.23
52 0.22
53 0.2
54 0.2
55 0.22
56 0.25
57 0.3
58 0.38
59 0.45
60 0.51