Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6S6F0

Protein Details
Accession A0A2Z6S6F0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
41-60QLKCIDRNRKSRPRELKPNEHydrophilic
NLS Segment(s)
PositionSequence
52-53RP
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences DNLQYQVVSVQSPFDASVELHKIITPNKKTAISGIHLFELQLKCIDRNRKSRPRELKPNEESSKTTQIKRAKGLAKKEQIHFEDSIKDFYNPKDRVVLKALNFTVENKEYHVSFGKDDDVKKNKNYIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.14
5 0.16
6 0.17
7 0.16
8 0.17
9 0.19
10 0.24
11 0.33
12 0.32
13 0.32
14 0.36
15 0.37
16 0.37
17 0.38
18 0.36
19 0.3
20 0.3
21 0.27
22 0.23
23 0.22
24 0.21
25 0.24
26 0.2
27 0.17
28 0.16
29 0.15
30 0.16
31 0.23
32 0.32
33 0.33
34 0.42
35 0.52
36 0.59
37 0.64
38 0.72
39 0.76
40 0.76
41 0.81
42 0.78
43 0.78
44 0.74
45 0.77
46 0.7
47 0.62
48 0.55
49 0.48
50 0.51
51 0.44
52 0.4
53 0.37
54 0.41
55 0.42
56 0.42
57 0.45
58 0.41
59 0.44
60 0.51
61 0.53
62 0.55
63 0.57
64 0.56
65 0.56
66 0.51
67 0.49
68 0.43
69 0.35
70 0.33
71 0.29
72 0.29
73 0.23
74 0.23
75 0.21
76 0.23
77 0.32
78 0.27
79 0.27
80 0.32
81 0.32
82 0.34
83 0.38
84 0.4
85 0.32
86 0.38
87 0.37
88 0.32
89 0.32
90 0.3
91 0.3
92 0.27
93 0.26
94 0.21
95 0.23
96 0.21
97 0.23
98 0.27
99 0.22
100 0.21
101 0.22
102 0.26
103 0.28
104 0.31
105 0.38
106 0.42
107 0.45
108 0.49