Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QMA9

Protein Details
Accession A0A2Z6QMA9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
98-124ASKPEQKLEKSIRRKKETRKLMKLMFKHydrophilic
NLS Segment(s)
PositionSequence
106-120EKSIRRKKETRKLMK
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MSTLRRRAALKRLVNPNQSGSLNQSRRNIDLLIYLHYKLFLQNLALRADSKPKISEIKAAKRKAALIKVLQEFQDPKDNVNVASSDCAKNLTQSEDNASKPEQKLEKSIRRKKETRKLMKLMFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.69
3 0.63
4 0.58
5 0.51
6 0.43
7 0.39
8 0.41
9 0.4
10 0.43
11 0.45
12 0.43
13 0.43
14 0.45
15 0.38
16 0.28
17 0.29
18 0.24
19 0.22
20 0.22
21 0.2
22 0.18
23 0.18
24 0.17
25 0.13
26 0.13
27 0.09
28 0.09
29 0.12
30 0.14
31 0.15
32 0.15
33 0.16
34 0.15
35 0.21
36 0.2
37 0.19
38 0.17
39 0.18
40 0.22
41 0.21
42 0.28
43 0.29
44 0.38
45 0.45
46 0.45
47 0.45
48 0.42
49 0.44
50 0.41
51 0.38
52 0.31
53 0.25
54 0.3
55 0.3
56 0.31
57 0.28
58 0.25
59 0.22
60 0.21
61 0.27
62 0.21
63 0.2
64 0.23
65 0.23
66 0.21
67 0.21
68 0.2
69 0.11
70 0.14
71 0.16
72 0.13
73 0.13
74 0.15
75 0.14
76 0.16
77 0.17
78 0.2
79 0.19
80 0.19
81 0.26
82 0.27
83 0.27
84 0.28
85 0.28
86 0.29
87 0.28
88 0.34
89 0.33
90 0.32
91 0.4
92 0.48
93 0.56
94 0.61
95 0.7
96 0.73
97 0.77
98 0.84
99 0.86
100 0.87
101 0.88
102 0.88
103 0.89
104 0.88