Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6S553

Protein Details
Accession A0A2Z6S553    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
54-79GFCSKHAKKIYHRVERERKRQQDVLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 9.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MDRLTCPHIKRDGSICDNNCTRLVGCLLHWKSGANKLLKTPCRICDEPTLSYTGFCSKHAKKIYHRVERERKRQQDVLSHITL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.51
3 0.5
4 0.5
5 0.49
6 0.43
7 0.36
8 0.29
9 0.22
10 0.21
11 0.15
12 0.15
13 0.23
14 0.23
15 0.23
16 0.23
17 0.22
18 0.23
19 0.28
20 0.33
21 0.25
22 0.25
23 0.28
24 0.36
25 0.39
26 0.42
27 0.38
28 0.36
29 0.41
30 0.41
31 0.38
32 0.39
33 0.39
34 0.36
35 0.34
36 0.32
37 0.25
38 0.24
39 0.23
40 0.2
41 0.16
42 0.17
43 0.24
44 0.23
45 0.32
46 0.39
47 0.44
48 0.47
49 0.57
50 0.66
51 0.69
52 0.74
53 0.76
54 0.8
55 0.85
56 0.87
57 0.87
58 0.85
59 0.83
60 0.81
61 0.76
62 0.75
63 0.72