Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RN10

Protein Details
Accession A0A2Z6RN10    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-101IIATVCYCKRDKKPRNNQHQLNVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, E.R. 5, cyto_mito 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MILTMTNLLNDFLQRIIKKYSLILLILINIIINNNSLGSGVMGDTGNEEDNNNTNGIHLNYPIPIVIGIGCTAVIIIIIIATVCYCKRDKKPRNNQHQLNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.22
4 0.23
5 0.24
6 0.24
7 0.26
8 0.22
9 0.21
10 0.19
11 0.15
12 0.14
13 0.13
14 0.12
15 0.08
16 0.06
17 0.06
18 0.05
19 0.05
20 0.04
21 0.04
22 0.04
23 0.05
24 0.05
25 0.04
26 0.04
27 0.04
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.06
34 0.06
35 0.06
36 0.06
37 0.07
38 0.08
39 0.08
40 0.07
41 0.07
42 0.08
43 0.09
44 0.09
45 0.09
46 0.08
47 0.08
48 0.09
49 0.08
50 0.07
51 0.06
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.03
61 0.03
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.04
70 0.05
71 0.08
72 0.11
73 0.19
74 0.3
75 0.41
76 0.52
77 0.62
78 0.74
79 0.81
80 0.9
81 0.94