Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RM15

Protein Details
Accession A0A2Z6RM15    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
118-144VWYGRLKEKQYHKRWNRKRKNLAELPDHydrophilic
NLS Segment(s)
PositionSequence
129-137HKRWNRKRK
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 7
Family & Domain DBs
Amino Acid Sequences MPPIVDSISKSHNNRHNPIYPSAILDQVKKLGKDFLESSLRPIVQQPIVIPRAIPSVSQRLEPPNPFPGAFPTLTPFQKQQLRKYLYCWKNRKIMQNNREKLAEEKFNLYLRRRAIYVWYGRLKEKQYHKRWNRKRKNLAELPDNFRPHSILKLSDKKSKFSRKVFRFCQNDKIYSYDPENDDQIRYIEIIGGKNYVYNEEIRKEVKRVLGIGNFYEEKYLYKAKTTKVWKMAFEQYREGKYADQQILKKLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.63
3 0.64
4 0.61
5 0.62
6 0.59
7 0.51
8 0.47
9 0.42
10 0.41
11 0.35
12 0.32
13 0.3
14 0.31
15 0.34
16 0.3
17 0.3
18 0.29
19 0.27
20 0.3
21 0.29
22 0.3
23 0.33
24 0.33
25 0.35
26 0.36
27 0.36
28 0.31
29 0.32
30 0.31
31 0.24
32 0.25
33 0.23
34 0.25
35 0.26
36 0.26
37 0.23
38 0.19
39 0.21
40 0.2
41 0.2
42 0.16
43 0.23
44 0.24
45 0.25
46 0.27
47 0.3
48 0.35
49 0.37
50 0.37
51 0.33
52 0.34
53 0.33
54 0.31
55 0.29
56 0.27
57 0.25
58 0.21
59 0.19
60 0.23
61 0.23
62 0.25
63 0.22
64 0.25
65 0.32
66 0.37
67 0.41
68 0.46
69 0.51
70 0.5
71 0.54
72 0.58
73 0.59
74 0.64
75 0.65
76 0.6
77 0.62
78 0.66
79 0.71
80 0.71
81 0.73
82 0.72
83 0.75
84 0.73
85 0.67
86 0.63
87 0.54
88 0.46
89 0.4
90 0.36
91 0.26
92 0.26
93 0.25
94 0.28
95 0.31
96 0.3
97 0.29
98 0.26
99 0.26
100 0.24
101 0.22
102 0.22
103 0.24
104 0.25
105 0.27
106 0.29
107 0.3
108 0.31
109 0.34
110 0.34
111 0.35
112 0.42
113 0.46
114 0.51
115 0.6
116 0.69
117 0.76
118 0.84
119 0.88
120 0.89
121 0.9
122 0.91
123 0.88
124 0.89
125 0.84
126 0.78
127 0.75
128 0.69
129 0.65
130 0.61
131 0.54
132 0.44
133 0.37
134 0.34
135 0.27
136 0.25
137 0.2
138 0.18
139 0.24
140 0.33
141 0.37
142 0.44
143 0.44
144 0.46
145 0.54
146 0.6
147 0.61
148 0.61
149 0.68
150 0.69
151 0.77
152 0.79
153 0.8
154 0.78
155 0.73
156 0.74
157 0.68
158 0.62
159 0.54
160 0.52
161 0.44
162 0.38
163 0.37
164 0.32
165 0.29
166 0.27
167 0.29
168 0.24
169 0.23
170 0.21
171 0.19
172 0.14
173 0.13
174 0.11
175 0.11
176 0.12
177 0.12
178 0.12
179 0.12
180 0.12
181 0.13
182 0.13
183 0.13
184 0.12
185 0.14
186 0.17
187 0.18
188 0.22
189 0.23
190 0.26
191 0.27
192 0.3
193 0.3
194 0.29
195 0.3
196 0.32
197 0.33
198 0.33
199 0.31
200 0.32
201 0.29
202 0.26
203 0.25
204 0.2
205 0.17
206 0.2
207 0.24
208 0.2
209 0.27
210 0.31
211 0.34
212 0.42
213 0.49
214 0.53
215 0.57
216 0.61
217 0.56
218 0.58
219 0.64
220 0.62
221 0.59
222 0.58
223 0.55
224 0.53
225 0.52
226 0.47
227 0.39
228 0.38
229 0.43
230 0.42
231 0.43
232 0.42