Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2LW41

Protein Details
Accession E2LW41    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
64-84LPPPPPPKKKSKKELELEEKWBasic
NLS Segment(s)
PositionSequence
57-76NRRTPPPLPPPPPPKKKSKK
Subcellular Location(s) nucl 17.5, mito_nucl 13.666, cyto_nucl 10.333, mito 8.5
Family & Domain DBs
KEGG mpr:MPER_11442  -  
Amino Acid Sequences MSELIRRVNAQPGSPFSPASSTKTATPYAKPGTPTAYSPYLKSSRSMLSRIAPLHPNRRTPPPLPPPPPPKKKSKKELELEEKWEEELVDSVGGMTEWLALSDQERKDMRKMKREKELYGWEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.27
4 0.31
5 0.3
6 0.31
7 0.29
8 0.26
9 0.28
10 0.3
11 0.34
12 0.32
13 0.32
14 0.33
15 0.34
16 0.35
17 0.34
18 0.32
19 0.32
20 0.31
21 0.3
22 0.28
23 0.3
24 0.28
25 0.27
26 0.31
27 0.3
28 0.29
29 0.29
30 0.27
31 0.26
32 0.27
33 0.28
34 0.25
35 0.24
36 0.27
37 0.27
38 0.27
39 0.27
40 0.29
41 0.36
42 0.37
43 0.4
44 0.39
45 0.45
46 0.47
47 0.43
48 0.48
49 0.48
50 0.54
51 0.53
52 0.58
53 0.62
54 0.67
55 0.75
56 0.69
57 0.71
58 0.73
59 0.77
60 0.8
61 0.8
62 0.79
63 0.78
64 0.84
65 0.83
66 0.77
67 0.73
68 0.65
69 0.55
70 0.45
71 0.37
72 0.27
73 0.18
74 0.14
75 0.08
76 0.06
77 0.06
78 0.05
79 0.05
80 0.05
81 0.04
82 0.03
83 0.04
84 0.04
85 0.04
86 0.05
87 0.05
88 0.07
89 0.14
90 0.15
91 0.21
92 0.23
93 0.26
94 0.35
95 0.43
96 0.5
97 0.54
98 0.63
99 0.66
100 0.74
101 0.77
102 0.74
103 0.74