Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QT49

Protein Details
Accession A0A2Z6QT49    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-28GESRKKMQELREKQKRNDKENBasic
38-63RLSQERTTRSRRQKMREKQMKTQSGTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MNVSRGLGESRKKMQELREKQKRNDKENTMNLEREKMRLSQERTTRSRRQKMREKQMKTQSGTTEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.6
4 0.65
5 0.68
6 0.71
7 0.76
8 0.82
9 0.82
10 0.78
11 0.76
12 0.73
13 0.71
14 0.71
15 0.71
16 0.64
17 0.58
18 0.52
19 0.47
20 0.4
21 0.32
22 0.27
23 0.21
24 0.23
25 0.27
26 0.32
27 0.34
28 0.4
29 0.47
30 0.51
31 0.58
32 0.62
33 0.66
34 0.71
35 0.72
36 0.76
37 0.79
38 0.84
39 0.87
40 0.88
41 0.85
42 0.85
43 0.87
44 0.86
45 0.8
46 0.75