Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6SGA7

Protein Details
Accession A0A2Z6SGA7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-26VVDLWKKPPGRNKILTRNDMKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MRWGAVVDLWKKPPGRNKILTRNDMKILQELVKDKIDWYLDELVGELEVSIDKLVSIPTLWRSLIYCEISRKKLHHAAYEWNELLRSTFIAKVGREYKPEQLIFMDEASKDERTLSRRYGYSLKNTFATKKNVFVCGVRYTILPALSLQGIIAVDIMEGSCTKERFKEFVILNVVPQINAYLSEHSVLVLDNVRIHHDKDLIEYIESFGGRVEFLPPYSPNFNPIESSFSVIKSFLQKYRDFVNSCSDPRXXLLIACTQITSNMVAKFFEDSIYM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.58
3 0.62
4 0.68
5 0.74
6 0.81
7 0.83
8 0.8
9 0.75
10 0.7
11 0.64
12 0.55
13 0.48
14 0.42
15 0.36
16 0.35
17 0.32
18 0.32
19 0.3
20 0.29
21 0.25
22 0.27
23 0.25
24 0.21
25 0.22
26 0.23
27 0.21
28 0.2
29 0.2
30 0.15
31 0.14
32 0.13
33 0.08
34 0.04
35 0.04
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.07
45 0.1
46 0.13
47 0.13
48 0.13
49 0.14
50 0.17
51 0.22
52 0.23
53 0.23
54 0.29
55 0.35
56 0.38
57 0.41
58 0.4
59 0.42
60 0.47
61 0.48
62 0.46
63 0.43
64 0.48
65 0.5
66 0.54
67 0.46
68 0.39
69 0.35
70 0.29
71 0.26
72 0.17
73 0.13
74 0.09
75 0.09
76 0.11
77 0.14
78 0.14
79 0.2
80 0.25
81 0.26
82 0.29
83 0.3
84 0.33
85 0.36
86 0.36
87 0.31
88 0.26
89 0.26
90 0.22
91 0.21
92 0.17
93 0.1
94 0.11
95 0.12
96 0.12
97 0.1
98 0.11
99 0.13
100 0.15
101 0.19
102 0.2
103 0.22
104 0.22
105 0.25
106 0.31
107 0.31
108 0.36
109 0.36
110 0.35
111 0.34
112 0.34
113 0.36
114 0.34
115 0.38
116 0.3
117 0.33
118 0.33
119 0.33
120 0.32
121 0.29
122 0.27
123 0.22
124 0.22
125 0.16
126 0.14
127 0.13
128 0.14
129 0.13
130 0.1
131 0.08
132 0.08
133 0.07
134 0.07
135 0.06
136 0.05
137 0.05
138 0.04
139 0.04
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.05
147 0.07
148 0.08
149 0.09
150 0.12
151 0.15
152 0.17
153 0.19
154 0.24
155 0.22
156 0.27
157 0.32
158 0.28
159 0.26
160 0.28
161 0.26
162 0.19
163 0.18
164 0.14
165 0.08
166 0.09
167 0.1
168 0.07
169 0.08
170 0.09
171 0.09
172 0.08
173 0.08
174 0.07
175 0.07
176 0.08
177 0.08
178 0.09
179 0.09
180 0.13
181 0.15
182 0.16
183 0.17
184 0.18
185 0.18
186 0.19
187 0.23
188 0.2
189 0.19
190 0.18
191 0.17
192 0.16
193 0.16
194 0.13
195 0.09
196 0.08
197 0.08
198 0.08
199 0.09
200 0.08
201 0.09
202 0.12
203 0.13
204 0.18
205 0.22
206 0.22
207 0.24
208 0.25
209 0.26
210 0.25
211 0.25
212 0.26
213 0.23
214 0.27
215 0.23
216 0.22
217 0.22
218 0.2
219 0.21
220 0.22
221 0.26
222 0.27
223 0.31
224 0.32
225 0.34
226 0.4
227 0.45
228 0.41
229 0.38
230 0.42
231 0.43
232 0.43
233 0.44
234 0.38
235 0.3
236 0.3
237 0.3
238 0.23
239 0.19
240 0.21
241 0.19
242 0.19
243 0.19
244 0.19
245 0.17
246 0.19
247 0.21
248 0.2
249 0.19
250 0.19
251 0.19
252 0.21
253 0.2