Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6SE79

Protein Details
Accession A0A2Z6SE79    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-38KCPNCKAPFKSDNRNYKKHKKTCKPKVVSNANPGNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.833, mito 11.5, nucl 11, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MTVKCPNCKAPFKSDNRNYKKHKKTCKPKVVSNANPGNGFSGTSSGNGFSSTPSGNVFSPVFSQESEHSCRTLAILYFRNFGIKYDRTNIDRLTLCAFGRTASEAFNRNICVVCGVKPKRFHDFVSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.79
4 0.84
5 0.83
6 0.84
7 0.87
8 0.85
9 0.87
10 0.87
11 0.9
12 0.92
13 0.93
14 0.89
15 0.87
16 0.87
17 0.87
18 0.83
19 0.81
20 0.76
21 0.68
22 0.61
23 0.53
24 0.44
25 0.34
26 0.27
27 0.17
28 0.12
29 0.1
30 0.1
31 0.1
32 0.09
33 0.08
34 0.09
35 0.08
36 0.07
37 0.09
38 0.08
39 0.08
40 0.09
41 0.1
42 0.09
43 0.12
44 0.11
45 0.1
46 0.1
47 0.11
48 0.11
49 0.09
50 0.11
51 0.1
52 0.14
53 0.17
54 0.17
55 0.16
56 0.16
57 0.16
58 0.15
59 0.15
60 0.12
61 0.12
62 0.17
63 0.18
64 0.19
65 0.19
66 0.21
67 0.19
68 0.19
69 0.22
70 0.18
71 0.2
72 0.25
73 0.29
74 0.29
75 0.32
76 0.32
77 0.3
78 0.29
79 0.28
80 0.25
81 0.23
82 0.21
83 0.2
84 0.19
85 0.14
86 0.14
87 0.15
88 0.13
89 0.13
90 0.16
91 0.19
92 0.2
93 0.23
94 0.23
95 0.21
96 0.22
97 0.19
98 0.2
99 0.17
100 0.2
101 0.28
102 0.33
103 0.38
104 0.46
105 0.5
106 0.55
107 0.58
108 0.57