Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QPV4

Protein Details
Accession A0A2Z6QPV4    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
25-55KEMLRRSINNKRAHQRKKKLRRNENKSDDDNBasic
77-96HYICRERYSKKIRIQRGDSSHydrophilic
NLS Segment(s)
PositionSequence
31-46SINNKRAHQRKKKLRR
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MIQIIERFKANNRKFPKITGDWYIKEMLRRSINNKRAHQRKKKLRRNENKSDDDNDDVDDASNEDVANSNSNIKTLHYICRERYSKKIRIQRGDSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.63
4 0.58
5 0.57
6 0.55
7 0.55
8 0.47
9 0.47
10 0.46
11 0.38
12 0.37
13 0.34
14 0.32
15 0.32
16 0.33
17 0.38
18 0.45
19 0.52
20 0.56
21 0.62
22 0.65
23 0.7
24 0.78
25 0.81
26 0.82
27 0.85
28 0.87
29 0.9
30 0.91
31 0.91
32 0.92
33 0.9
34 0.9
35 0.88
36 0.83
37 0.76
38 0.68
39 0.6
40 0.51
41 0.42
42 0.31
43 0.23
44 0.17
45 0.14
46 0.1
47 0.08
48 0.06
49 0.06
50 0.05
51 0.05
52 0.06
53 0.06
54 0.08
55 0.08
56 0.12
57 0.12
58 0.13
59 0.13
60 0.13
61 0.19
62 0.19
63 0.26
64 0.3
65 0.35
66 0.38
67 0.48
68 0.52
69 0.51
70 0.59
71 0.6
72 0.62
73 0.67
74 0.73
75 0.73
76 0.77