Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6SJ68

Protein Details
Accession A0A2Z6SJ68    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
77-103VVTSVNKSQKKKKKIKIQNPLKCKGKAHydrophilic
NLS Segment(s)
PositionSequence
85-93QKKKKKIKI
Subcellular Location(s) nucl 15, cyto_nucl 12.833, cyto 9.5, mito_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
Amino Acid Sequences MLSDGEWKLMQQLTKLLQSFYDVTKLFSGEKYATVSFIYYVVVSLQVKAIPKEIQMVDLMTRAFDDVEFEDGNDVIVVTSVNKSQKKKKKIKIQNPLKCKGKAEELHHLLLHYW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.25
4 0.23
5 0.25
6 0.26
7 0.22
8 0.24
9 0.19
10 0.2
11 0.21
12 0.21
13 0.19
14 0.17
15 0.19
16 0.14
17 0.15
18 0.17
19 0.16
20 0.15
21 0.14
22 0.14
23 0.11
24 0.11
25 0.1
26 0.06
27 0.06
28 0.05
29 0.07
30 0.07
31 0.07
32 0.07
33 0.08
34 0.09
35 0.1
36 0.12
37 0.1
38 0.1
39 0.14
40 0.13
41 0.12
42 0.12
43 0.12
44 0.1
45 0.11
46 0.1
47 0.06
48 0.06
49 0.06
50 0.05
51 0.05
52 0.06
53 0.05
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.06
61 0.06
62 0.03
63 0.03
64 0.04
65 0.04
66 0.05
67 0.08
68 0.15
69 0.2
70 0.26
71 0.37
72 0.46
73 0.57
74 0.67
75 0.74
76 0.79
77 0.85
78 0.9
79 0.91
80 0.93
81 0.92
82 0.9
83 0.89
84 0.86
85 0.78
86 0.71
87 0.64
88 0.63
89 0.61
90 0.59
91 0.6
92 0.57
93 0.57
94 0.54