Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6RMM1

Protein Details
Accession A0A2Z6RMM1    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
193-216LTGKSDAKKMIKRNKSNFEQKIQLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, nucl 10.5, cyto_mito 7.833, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR024079  MetalloPept_cat_dom_sf  
IPR001506  Peptidase_M12A  
IPR006026  Peptidase_Metallo  
Gene Ontology GO:0004222  F:metalloendopeptidase activity  
GO:0008270  F:zinc ion binding  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF01400  Astacin  
PROSITE View protein in PROSITE  
PS51864  ASTACIN  
Amino Acid Sequences MREPCSDNCTNDSRKLWGKGIVSYCFDNGVSKNLIHSVKSAMKEISEASSIRFVKRTDQFDYVKIVDKGSYWSYVVTNGWPHPIGSAIHELMHALGIYHEHCRPDRDKYVTIKDDIKNNTNYKRLKKSNVVSFGPYDFKSIMHYSLGPDMTSKQEVNDKIGQRFRMSEGDIYALNKLYPSTSCSPASDDQIGLTGKSDAKKMIKRNKSNFEQKIQLIIITRRRTLYRLAKLIHYII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.49
4 0.48
5 0.45
6 0.46
7 0.49
8 0.46
9 0.42
10 0.38
11 0.35
12 0.3
13 0.28
14 0.24
15 0.2
16 0.2
17 0.19
18 0.17
19 0.18
20 0.23
21 0.24
22 0.21
23 0.22
24 0.24
25 0.27
26 0.28
27 0.3
28 0.25
29 0.23
30 0.24
31 0.24
32 0.2
33 0.17
34 0.15
35 0.14
36 0.21
37 0.22
38 0.22
39 0.25
40 0.23
41 0.29
42 0.36
43 0.39
44 0.36
45 0.42
46 0.42
47 0.41
48 0.45
49 0.39
50 0.37
51 0.33
52 0.28
53 0.22
54 0.21
55 0.22
56 0.19
57 0.19
58 0.13
59 0.14
60 0.13
61 0.14
62 0.14
63 0.13
64 0.14
65 0.13
66 0.15
67 0.14
68 0.14
69 0.12
70 0.13
71 0.12
72 0.11
73 0.14
74 0.12
75 0.12
76 0.12
77 0.12
78 0.1
79 0.1
80 0.07
81 0.04
82 0.04
83 0.04
84 0.05
85 0.08
86 0.09
87 0.11
88 0.12
89 0.15
90 0.18
91 0.23
92 0.29
93 0.31
94 0.35
95 0.38
96 0.45
97 0.43
98 0.43
99 0.43
100 0.39
101 0.4
102 0.38
103 0.37
104 0.35
105 0.37
106 0.39
107 0.4
108 0.43
109 0.43
110 0.5
111 0.51
112 0.51
113 0.55
114 0.58
115 0.58
116 0.6
117 0.55
118 0.47
119 0.44
120 0.4
121 0.34
122 0.28
123 0.22
124 0.15
125 0.14
126 0.16
127 0.15
128 0.15
129 0.13
130 0.13
131 0.12
132 0.15
133 0.15
134 0.12
135 0.11
136 0.12
137 0.13
138 0.15
139 0.14
140 0.12
141 0.17
142 0.18
143 0.23
144 0.28
145 0.29
146 0.33
147 0.37
148 0.37
149 0.33
150 0.34
151 0.32
152 0.29
153 0.27
154 0.23
155 0.2
156 0.19
157 0.19
158 0.18
159 0.16
160 0.13
161 0.11
162 0.1
163 0.09
164 0.09
165 0.09
166 0.14
167 0.17
168 0.21
169 0.22
170 0.23
171 0.28
172 0.29
173 0.32
174 0.28
175 0.24
176 0.2
177 0.22
178 0.22
179 0.17
180 0.16
181 0.13
182 0.15
183 0.16
184 0.17
185 0.19
186 0.26
187 0.33
188 0.42
189 0.51
190 0.59
191 0.68
192 0.76
193 0.81
194 0.83
195 0.87
196 0.84
197 0.8
198 0.77
199 0.67
200 0.64
201 0.54
202 0.47
203 0.41
204 0.41
205 0.43
206 0.4
207 0.42
208 0.4
209 0.42
210 0.42
211 0.46
212 0.5
213 0.51
214 0.54
215 0.54
216 0.54