Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6R7K6

Protein Details
Accession A0A2Z6R7K6    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-36IKEIWRSRKIQEKTKGRRNKDKRSEDKTEKKNEIBasic
NLS Segment(s)
PositionSequence
8-33RSRKIQEKTKGRRNKDKRSEDKTEKK
Subcellular Location(s) nucl 21.5, mito_nucl 14, mito 5.5
Family & Domain DBs
Amino Acid Sequences MMIKEIWRSRKIQEKTKGRRNKDKRSEDKTEKKNEIERNKDEIERIITIFPIRGSRFVIQYKTKLLRWMLIFYRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.73
3 0.81
4 0.85
5 0.83
6 0.88
7 0.88
8 0.88
9 0.88
10 0.89
11 0.88
12 0.86
13 0.87
14 0.86
15 0.86
16 0.84
17 0.81
18 0.75
19 0.68
20 0.67
21 0.66
22 0.64
23 0.62
24 0.57
25 0.54
26 0.52
27 0.49
28 0.42
29 0.35
30 0.29
31 0.23
32 0.19
33 0.14
34 0.13
35 0.12
36 0.12
37 0.11
38 0.13
39 0.13
40 0.14
41 0.18
42 0.19
43 0.24
44 0.27
45 0.32
46 0.32
47 0.35
48 0.42
49 0.43
50 0.43
51 0.44
52 0.42
53 0.42
54 0.4
55 0.44
56 0.43